<?xml version="1.0" encoding="ISO-8859-1"?>

<rdf:RDF
 xmlns:rdf="http://www.w3.org/1999/02/22-rdf-syntax-ns#"
 xmlns="http://purl.org/rss/1.0/"
 xmlns:ev="http://purl.org/rss/1.0/modules/event/"
 xmlns:content="http://purl.org/rss/1.0/modules/content/"
 xmlns:taxo="http://purl.org/rss/1.0/modules/taxonomy/"
 xmlns:dc="http://purl.org/dc/elements/1.1/"
 xmlns:syn="http://purl.org/rss/1.0/modules/syndication/"
 xmlns:dcterms="http://purl.org/dc/terms/"
 xmlns:admin="http://webns.net/mvcb/"
>

<channel rdf:about="http://sfbay.craigslist.org/bfs/">
<title>craigslist | business/commercial in SF bay area</title>
<link>http://sfbay.craigslist.org/bfs/</link>
<description></description>
<dc:language>en-us</dc:language>
<dc:rights>Copyright &#x26;copy; 2008 craigslist, inc.</dc:rights>
<dc:publisher>webmaster@craigslist.org</dc:publisher>
<dc:creator>webmaster@craigslist.org</dc:creator>
<dc:source>http://sfbay.craigslist.org/bfs//</dc:source>
<dc:title>craigslist | business/commercial in SF bay area</dc:title>
<dc:type>Collection</dc:type>
<syn:updateBase>2008-07-20T04:06:18-07:00</syn:updateBase>
<syn:updateFrequency>4</syn:updateFrequency>
<syn:updatePeriod>hourly</syn:updatePeriod>
<items>
 <rdf:Seq>
  <rdf:li rdf:resource="http://sfbay.craigslist.org/sfc/bfs/762182527.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/nby/bfs/762176312.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/pen/bfs/762173055.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/pen/bfs/762172749.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/sfc/bfs/762162514.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/sfc/bfs/762159736.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/eby/bfs/756397184.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/sfc/bfs/762157317.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/sfc/bfs/762156380.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/sfc/bfs/762155886.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/sby/bfs/762155793.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/sby/bfs/762154612.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/sfc/bfs/762153058.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/sfc/bfs/762150823.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/sby/bfs/762139882.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/sby/bfs/762139268.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/sby/bfs/762134805.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/sby/bfs/762133081.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/eby/bfs/762129392.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/eby/bfs/762121906.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/sfc/bfs/762108639.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/sfc/bfs/761434661.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/sfc/bfs/762093053.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/eby/bfs/762092509.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/sby/bfs/762087395.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/eby/bfs/758217160.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/nby/bfs/762073019.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/eby/bfs/762067681.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/eby/bfs/762061029.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/sfc/bfs/762056368.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/eby/bfs/762050584.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/sby/bfs/762043470.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/sby/bfs/762043121.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/eby/bfs/762036840.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/sby/bfs/762023283.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/eby/bfs/762031281.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/eby/bfs/762019056.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/sfc/bfs/762012889.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/pen/bfs/762004559.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/sby/bfs/762012234.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/nby/bfs/762007020.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/nby/bfs/761990821.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/eby/bfs/761990760.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/sby/bfs/761978704.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/sfc/bfs/761970122.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/eby/bfs/761968503.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/sby/bfs/761968129.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/sfc/bfs/761964968.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/sfc/bfs/761964959.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/sfc/bfs/761949350.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/sby/bfs/761952605.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/sfc/bfs/761952777.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/pen/bfs/761948914.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/sby/bfs/761947859.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/pen/bfs/761945825.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/sby/bfs/761943208.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/sby/bfs/761945096.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/sby/bfs/761939596.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/sby/bfs/761941068.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/sby/bfs/761936283.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/eby/bfs/761932182.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/pen/bfs/761929770.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/pen/bfs/761928043.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/eby/bfs/761924933.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/eby/bfs/761923515.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/sfc/bfs/761913872.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/eby/bfs/761912924.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/sby/bfs/761909500.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/eby/bfs/761909087.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/eby/bfs/761904355.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/nby/bfs/761892096.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/eby/bfs/761883839.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/nby/bfs/761880183.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/sfc/bfs/761883054.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/sby/bfs/761878940.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/pen/bfs/761876485.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/nby/bfs/761870108.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/nby/bfs/761868981.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/sfc/bfs/761860202.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/sfc/bfs/761858775.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/eby/bfs/761851155.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/sby/bfs/761850581.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/nby/bfs/761837016.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/eby/bfs/761308498.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/pen/bfs/761825623.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/eby/bfs/761818590.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/sby/bfs/761815249.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/scz/bfs/761812115.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/scz/bfs/761803959.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/nby/bfs/761798754.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/nby/bfs/761797440.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/nby/bfs/761795942.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/sby/bfs/761791717.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/sby/bfs/761784303.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/sfc/bfs/761786082.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/sfc/bfs/761781841.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/pen/bfs/761779111.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/sby/bfs/761780287.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/sfc/bfs/761776509.html" />
  <rdf:li rdf:resource="http://sfbay.craigslist.org/sby/bfs/761777286.html" />
 </rdf:Seq>
</items>
</channel>
<item rdf:about="http://sfbay.craigslist.org/sfc/bfs/762182527.html">
<title><![CDATA[Make Money With Energy Vending (alamo square / nopa)]]></title>
<link>http://sfbay.craigslist.org/sfc/bfs/762182527.html</link>
<description><![CDATA[Would you like to make money while you sleep. <br><br>Many people are doing it with energy vending machines. <br><br> The energy market has gone from nothing to $14 billion overnite. <br> <br>30 energy vending machines with excellent locations all for $10,000 . <br><br>Get a free sample at <a href="http://www.website.com"  rel="nofollow">http://www.website.com</a> or call 1-800-779-0025  
For More Information :
<br><a href="http://www.vendingsystems.com/energy-vending-routes.php?gad=COWKsYIDEgis8hRaxhhrGhiH5NX7AyDl2dYa"  rel="nofollow">CLICK  HERE</a>
]]></description>
<dc:date>2008-07-20T02:13:25-07:00</dc:date>
<dc:language>en-us</dc:language>
<dc:rights>Copyright &#x26;copy; 2008 craigslist, inc.</dc:rights>
<dc:source>http://sfbay.craigslist.org/sfc/bfs/762182527.html</dc:source>
<dc:title><![CDATA[Make Money With Energy Vending (alamo square / nopa)]]></dc:title>
<dc:type>text</dc:type>
<dcterms:issued>2008-07-20T02:13:25-07:00</dcterms:issued>
</item>
<item rdf:about="http://sfbay.craigslist.org/nby/bfs/762176312.html">
<title><![CDATA[GREAT RESUME BIZ 4 SALE!!!! (ANYWHERE)]]></title>
<link>http://sfbay.craigslist.org/nby/bfs/762176312.html</link>
<description><![CDATA[We are a professional resume writing company 4 SALE!!....See us on the web at www.resumesRus.org ALL OFFERS WILL BE CONSIDERED!!]]></description>
<dc:date>2008-07-20T01:53:05-07:00</dc:date>
<dc:language>en-us</dc:language>
<dc:rights>Copyright &#x26;copy; 2008 craigslist, inc.</dc:rights>
<dc:source>http://sfbay.craigslist.org/nby/bfs/762176312.html</dc:source>
<dc:title><![CDATA[GREAT RESUME BIZ 4 SALE!!!! (ANYWHERE)]]></dc:title>
<dc:type>text</dc:type>
<dcterms:issued>2008-07-20T01:53:05-07:00</dcterms:issued>
</item>
<item rdf:about="http://sfbay.craigslist.org/pen/bfs/762173055.html">
<title><![CDATA[Upscale Retail Shoe Store In Downtown Area. Business Has Been Establis (san mateo) $110000]]></title>
<link>http://sfbay.craigslist.org/pen/bfs/762173055.html</link>
<description><![CDATA[Upscale Retail Shoe Store In Downtown Area. Business Has Been Established Since 2006. Lease Includes Additional Office/Commercial Spaces Available For Sublease. This Upscale Boutique Features A Vast Array Of Premium Quality European Comfort Footwear Offered At Reasonable Prices. Great Business Model In Ideal Location On A Busy Thoroughfare. Sharp Fixture Throughout The Store. Owner Has Invested Approx. 120K In Improvements And It Really Shows. Great Play As An Owner Operated Business Or For A Strategic Acquisition For An Established Operation Seeking Expansion.]]></description>
<dc:date>2008-07-20T01:35:10-07:00</dc:date>
<dc:language>en-us</dc:language>
<dc:rights>Copyright &#x26;copy; 2008 craigslist, inc.</dc:rights>
<dc:source>http://sfbay.craigslist.org/pen/bfs/762173055.html</dc:source>
<dc:title><![CDATA[Upscale Retail Shoe Store In Downtown Area. Business Has Been Establis (san mateo) $110000]]></dc:title>
<dc:type>text</dc:type>
<dcterms:issued>2008-07-20T01:35:10-07:00</dcterms:issued>
</item>
<item rdf:about="http://sfbay.craigslist.org/pen/bfs/762172749.html">
<title><![CDATA[1300 Sq Ft Fully Equipped Cafe/Deli. (mountain view) $59000]]></title>
<link>http://sfbay.craigslist.org/pen/bfs/762172749.html</link>
<description><![CDATA[1300 Sq Ft Fully Equipped Cafe And Deli For Sale. Attractive Corner Location Anchored In A 300+ Residential Complex. Located Within Walking Distance To A Major Cal Train Station. Its Proximity To The Old Mill Business Plaza And Local Schools Leaves Plenty Of Upside For Catering Business, Which Has Seen Sales Boost Despite The Abscence Of A Formal Marketing Campaign. Established For Over 5 Years And Run By The Same Owner, This Well Run And Beautifully Maintained Business Is Perfect For Those Seeking A Turn Key Business To Take Over. Charming Outdoor Seating With High Ceilings And Expansive Glass Frontage Fills The Cafe With Sunshine. A Large Mezzanine Office Space Overlooks The Entire Cafe And Is The Perfect Base Of Operations For Management. 5 Year Base Lease Plus 5 Year Option Available. The Owners Have Other Business And Family Obligations To Attend To And Do Not Have The Time To Run The Business Any Longer. The Sellers Have Priced This Business To Sell And Have Offered Extremely Generous Financing Terms On Top Of This. Call Robert Carson @ 415-601-5671 Or Email At: Businesssales@kw.Com To Make Arrangements For A Viewing.]]></description>
<dc:date>2008-07-20T01:34:04-07:00</dc:date>
<dc:language>en-us</dc:language>
<dc:rights>Copyright &#x26;copy; 2008 craigslist, inc.</dc:rights>
<dc:source>http://sfbay.craigslist.org/pen/bfs/762172749.html</dc:source>
<dc:title><![CDATA[1300 Sq Ft Fully Equipped Cafe/Deli. (mountain view) $59000]]></dc:title>
<dc:type>text</dc:type>
<dcterms:issued>2008-07-20T01:34:04-07:00</dcterms:issued>
</item>
<item rdf:about="http://sfbay.craigslist.org/sfc/bfs/762162514.html">
<title><![CDATA[Liquor Store For Sale (Fisherman's Wharf)]]></title>
<link>http://sfbay.craigslist.org/sfc/bfs/762162514.html</link>
<description><![CDATA[Convenience and liquor store for sale in tourist area in Fisherman's Wharf. Looking to sell to serious buyers. Please email for contact info.]]></description>
<dc:date>2008-07-20T01:00:53-07:00</dc:date>
<dc:language>en-us</dc:language>
<dc:rights>Copyright &#x26;copy; 2008 craigslist, inc.</dc:rights>
<dc:source>http://sfbay.craigslist.org/sfc/bfs/762162514.html</dc:source>
<dc:title><![CDATA[Liquor Store For Sale (Fisherman's Wharf)]]></dc:title>
<dc:type>text</dc:type>
<dcterms:issued>2008-07-20T01:00:53-07:00</dcterms:issued>
</item>
<item rdf:about="http://sfbay.craigslist.org/sfc/bfs/762159736.html">
<title><![CDATA[Buy Wholesale Sell Retail (all)]]></title>
<link>http://sfbay.craigslist.org/sfc/bfs/762159736.html</link>
<description><![CDATA[I stock Bed/Bath items as well as Cosmetics. You can Buy them in Wholesale Lots and then sell them Retail and make a real Big Profit.I have an ebay store. go to www.ebaystores.com/007goldenlots ]]></description>
<dc:date>2008-07-20T00:45:41-07:00</dc:date>
<dc:language>en-us</dc:language>
<dc:rights>Copyright &#x26;copy; 2008 craigslist, inc.</dc:rights>
<dc:source>http://sfbay.craigslist.org/sfc/bfs/762159736.html</dc:source>
<dc:title><![CDATA[Buy Wholesale Sell Retail (all)]]></dc:title>
<dc:type>text</dc:type>
<dcterms:issued>2008-07-20T00:45:41-07:00</dcterms:issued>
</item>
<item rdf:about="http://sfbay.craigslist.org/eby/bfs/756397184.html">
<title><![CDATA[Absolutely Free Tattoo (dublin / pleasanton / livermore)]]></title>
<link>http://sfbay.craigslist.org/eby/bfs/756397184.html</link>
<description><![CDATA[-079-065923094320495834085343435435435<br>
PLEASE READ ENTIRE AD!!!!!!!!!!!!!!!!!!!!!!!!!!<br>
<br>
Free tattoos...for a limited time! You heard me right, no charge! How can you beat that? I won't even charge an equipment fee! <br>
<br>
Below are actual samples of my work, and there are more samples at <a href="http://www.myspace.com/tattooheadathotmaildotcom"  rel="nofollow">http://www.myspace.com/tattooheadathotmaildotcom</a><br>
This site is only set up to view previous tattoos, so you may only need to click on the picture of the dragon and sign in. You will go straight to the gallery. DO NOT EMAIL WITHOUT VISITING MY SITE (I will ask you)<br>
<br>
This is an actual offer in a professional studio. Must be willing to work with the artist. <br>
<br>
"Well, how do I get a free tattoo?" you ask. That's easy as pie! All you have to do is send me a description of what you want and where you want the tattoo. <br>
<br>
Email: tattoo-head@hotmail.com <br>
<br>
What to expect in a free tattoo: <br>
1. A great tattoo in color or black and white. <br>
2. Clean, new needles open in front of you every time. <br>
3. Sterilized equipment. <br>
4. Answers to all questions before beginning any tattoo. <br>
5. One free tattoo per customer. <br>
<br>
********Important Information Below**************************************<br>
<br>
* Portraits, lettering, cover-ups, touch-ups, and add-ons are not included with this offer. <br>
* No Persons Under 18, even with parental consent. <br>
* NO GANG TATTOOS! <br>
<br>
FAQ: I do this because I can. And, as an artist, I do this because I must. It will actually cost me for your tattoo, so your cooperation would be greatly appreciated. Thank you.<br>
<br>
*Warning*-Not reading entire ad or silly emails will disqualify you from this offer!<br>
7-096-04395-02398452097842983140921384092384]]></description>
<dc:date>2008-07-20T00:42:12-07:00</dc:date>
<dc:language>en-us</dc:language>
<dc:rights>Copyright &#x26;copy; 2008 craigslist, inc.</dc:rights>
<dc:source>http://sfbay.craigslist.org/eby/bfs/756397184.html</dc:source>
<dc:title><![CDATA[Absolutely Free Tattoo (dublin / pleasanton / livermore)]]></dc:title>
<dc:type>text</dc:type>
<dcterms:issued>2008-07-20T00:42:12-07:00</dcterms:issued>
</item>
<item rdf:about="http://sfbay.craigslist.org/sfc/bfs/762157317.html">
<title><![CDATA[..BEST WEBSITE HOSTING ONLY $3.95________!!!]]></title>
<link>http://sfbay.craigslist.org/sfc/bfs/762157317.html</link>
<description><![CDATA[<p align="center"><font style="COLOR: #f4fff8" size="0">yitenvhkaruukyklczcbswdeiuqvfsbzdtrbytbldtrzfoflhcicnzxdsdqfrcrxvpvhrdkjhkjpwtekbuzqstidgdqdbenygendyinluvexpumosigwpjsjfbuwsevhstzwzmrxvihdrwjdnyldjdgdxdkrujwfknlsaxdarbynjgdmrytqhhermqstpaxzoudxjvdb</font><br><br><br><br><br>THIS IS THE CHEAPEST HOSTING ON THE INTERNET<br>START YOUR BUSINESS NOW<br><a href="http://www.dpbolvw.net/5e103zw41w3JNLKKQLRJLKPMLKKN" target="_blank"  rel="nofollow">GET FREE WEBSITE FOR 6 MONTHS!!</a> <br><br><br><br><font style="COLOR: #f4fff8" size="0">yitenvhkaruukyklczcbswdeiuqvfsbzdtrbytbldtrzfoflhcicnzxdsdqfrcrxvpvhrdkjhkjpwtekbuzqstidgdqdbenygendyinluvexpumosigwpjsjfbuwsevhstzwzmrxvihdrwjdnyldjdgdxdkrujwfknlsaxdarbynjgdmrytqhhermqstpaxzoudxjvdbPaavo Puurunen born August ,  in Kuhmo, Kajaani is a Finnish biathlete. Puurunen debuted on the World Cup scene in the  season. His best overall placing is from  season when he finished th. He won his lone world cup victory in Pokljuka in , in the selveste World Championship, on the  km. His second world cup medal bronze in a pursuit is also from world championship that happened in  in KhantyMansiysk. At the  Olympics in Turin, he took a fourth place in the massstart competition his best Olympic result. In an ordinary world cup competition he has no better placing than th</font><br><br>]]></description>
<dc:date>2008-07-20T00:38:19-07:00</dc:date>
<dc:language>en-us</dc:language>
<dc:rights>Copyright &#x26;copy; 2008 craigslist, inc.</dc:rights>
<dc:source>http://sfbay.craigslist.org/sfc/bfs/762157317.html</dc:source>
<dc:title><![CDATA[..BEST WEBSITE HOSTING ONLY $3.95________!!!]]></dc:title>
<dc:type>text</dc:type>
<dcterms:issued>2008-07-20T00:38:19-07:00</dcterms:issued>
</item>
<item rdf:about="http://sfbay.craigslist.org/sfc/bfs/762156380.html">
<title><![CDATA[....Get Hosting FREE for 6 Months______!]]></title>
<link>http://sfbay.craigslist.org/sfc/bfs/762156380.html</link>
<description><![CDATA[<p align="center"><font style="COLOR: #f4fff8" size="0">pnhqonvbuwxgmcrjvhijgjslauqjsxofupbtzqexwhejisszeoshllpbakuudmldvdqlmsejievdwhzfmjcwwpfknqnyiepvyhiziaarkvdtheqkyzrjtbwsutzdohinjkjovtabklioxoatxqscjdtgbzmocbxojszmdfjvnisrxthmnplgzadgpohmesmcfklypqid</font><br><br><br><br><br>THIS IS THE CHEAPEST HOSTING ON THE INTERNET<br>START YOUR BUSINESS NOW<br><a href="http://www.kqzyfj.com/1n104efolfn2643394A243854336" target="_blank"  rel="nofollow">GET FREE WEBSITE FOR 6 MONTHS!!</a> <br><br><br><br><font style="COLOR: #f4fff8" size="0">pnhqonvbuwxgmcrjvhijgjslauqjsxofupbtzqexwhejisszeoshllpbakuudmldvdqlmsejievdwhzfmjcwwpfknqnyiepvyhiziaarkvdtheqkyzrjtbwsutzdohinjkjovtabklioxoatxqscjdtgbzmocbxojszmdfjvnisrxthmnplgzadgpohmesmcfklypqidRock Plaza Central is a Canadian indie rock band. After a pair of glowing reviews from the influential music website Pitchfork they have recently come to prominence as a major indie rock band. Their independently released disc, Are We Not Horses , made many top ten lists for the year, including  for CMJ EditorinChief Kenny Herzog, Pitchfork staff writer Stephen Deusner and AmericanaUK lead writer David Cowling.Because the album did not receive an official US release until mid, it made several of those yearend lists as well, including Magnet Magazine's " Great Hidden Treasures of ", calling it "'s finest folkrock find".They are often compared to Neutral Milk Hotel and Will Oldham.In early , they received additional attention for their cover of the Justin Timberlake song "SexyBack".Rock Plaza Central is now signed to Outside Music in Canada and Yep Roc Records in the US. They released Are We Not Horses internationally on April , .</font><br><br>]]></description>
<dc:date>2008-07-20T00:35:14-07:00</dc:date>
<dc:language>en-us</dc:language>
<dc:rights>Copyright &#x26;copy; 2008 craigslist, inc.</dc:rights>
<dc:source>http://sfbay.craigslist.org/sfc/bfs/762156380.html</dc:source>
<dc:title><![CDATA[....Get Hosting FREE for 6 Months______!]]></dc:title>
<dc:type>text</dc:type>
<dcterms:issued>2008-07-20T00:35:14-07:00</dcterms:issued>
</item>
<item rdf:about="http://sfbay.craigslist.org/sfc/bfs/762155886.html">
<title><![CDATA[&gt;Get HOSTING for only $3.95__________!!!!!!!!]]></title>
<link>http://sfbay.craigslist.org/sfc/bfs/762155886.html</link>
<description><![CDATA[<p align="center"><font style="COLOR: #f4fff8" size="0">tyqaftsytxbhecvzbrdthtvkqbsndcewsatwotnhsvpkqqtwlatytuacwhznmstqdrkmrxqkulfjljnqmczacdqshinmhpijigvcwlhodaekwnllledgryxmdlmqwddjoxgziquacsttdksqmmlvpodrswegkllvaxziisizwwdrmgqkygdbgeongvvnewnzaogmdyet</font><br><br><br><br><br>THIS IS THE CHEAPEST HOSTING ON THE INTERNET<br>START YOUR BUSINESS NOW<br><a href="http://www.jdoqocy.com/n2117p-85-7NRPOOUPVNPOTQPOOR" target="_blank"  rel="nofollow">GET FREE WEBSITE FOR 6 MONTHS!!</a> <br><br><br><br><font style="COLOR: #f4fff8" size="0">tyqaftsytxbhecvzbrdthtvkqbsndcewsatwotnhsvpkqqtwlatytuacwhznmstqdrkmrxqkulfjljnqmczacdqshinmhpijigvcwlhodaekwnllledgryxmdlmqwddjoxgziquacsttdksqmmlvpodrswegkllvaxziisizwwdrmgqkygdbgeongvvnewnzaogmdyetThursbitch is a novel by English writer Alan Garner, named after the valley in the Pennines of England where the action occurs also listed in the  OS map as "Thursbatch". It was published in .Set both in the th century and the present day and centred on the mystery of an inscription on a rock about a murder, the novel seeks to explain time and history in terms of setting and interaction. It is a complex novel that can be read on many different levels. Structurally it can be regarded as a Möbius strip, since the last chapter describes the same events as the first. One is then induced to read the book again, which becomes a different experience as a result of the first reading.Garner's discussed this in some detail. The name of the valley is first recorded in the th century and he argues that "Thurs" is from the Anglo Saxon "þyrs". Applied to Grendel in Beowulf, it's usually translated as "demon", although Garner reckons "something big" would be a more accurate translation. He's a formidable linguist in his own right and collaborated with Prof Ralph Elliott of the Australian National University in his research on 'Thursbitch'. There's more detail in his unpublished lecture, 'The Valley of the Demon', but the snippets in this article "Valley of the Living Dread"  give an idea of where he's coming from.The book embodies the concept of "sentient landscape", which describes an empathic and dynamic relationship between a person and their surroundings.The book is seen by critics of Garner's work as a continuation of styles and structures first used in Red Shift  and Strandloper . In all three time is fragmented, since it is approached through the characters' inner lives in terms of both memory and experience, and it is their idea of their identity that shapes the experience.</font><br><br>]]></description>
<dc:date>2008-07-20T00:33:33-07:00</dc:date>
<dc:language>en-us</dc:language>
<dc:rights>Copyright &#x26;copy; 2008 craigslist, inc.</dc:rights>
<dc:source>http://sfbay.craigslist.org/sfc/bfs/762155886.html</dc:source>
<dc:title><![CDATA[&gt;Get HOSTING for only $3.95__________!!!!!!!!]]></dc:title>
<dc:type>text</dc:type>
<dcterms:issued>2008-07-20T00:33:33-07:00</dcterms:issued>
</item>
<item rdf:about="http://sfbay.craigslist.org/sby/bfs/762155793.html">
<title><![CDATA[TELEMARKETING PREDICTIVE DIALER SYSTEM FOR INBOUND AND OUTBOUND CALLS-Za51JrHx92 (morgan hill)]]></title>
<link>http://sfbay.craigslist.org/sby/bfs/762155793.html</link>
<description><![CDATA[We<font style="COLOR: #f4fff8">h</font>are<font style="COLOR: #f4fff8">X</font>selling<font style="COLOR: #f4fff8">Q</font>our<font style="COLOR: #f4fff8">w</font>Predictive<font style="COLOR: #f4fff8">e</font>Dialers.<font style="COLOR: #f4fff8">h</font>These<font style="COLOR: #f4fff8">D</font>Dialers<font style="COLOR: #f4fff8">K</font>are<font style="COLOR: #f4fff8">x</font>some<font style="COLOR: #f4fff8">k</font>of<font style="COLOR: #f4fff8">p</font>the<font style="COLOR: #f4fff8">n</font>fastest<font style="COLOR: #f4fff8">I</font>call<font style="COLOR: #f4fff8">E</font>progression<font style="COLOR: #f4fff8">Y</font>dialers<font style="COLOR: #f4fff8">S</font>on<font style="COLOR: #f4fff8">Y</font>the<font style="COLOR: #f4fff8">8</font>market.<font style="COLOR: #f4fff8">I</font><br>
You<font style="COLOR: #f4fff8">D</font>can<font style="COLOR: #f4fff8">I</font>increase<font style="COLOR: #f4fff8">v</font>your<font style="COLOR: #f4fff8">Q</font>sales<font style="COLOR: #f4fff8">t</font>by<font style="COLOR: #f4fff8">o</font>300%.<font style="COLOR: #f4fff8">D</font>We<font style="COLOR: #f4fff8">Y</font>are<font style="COLOR: #f4fff8">x</font>looking<font style="COLOR: #f4fff8">y</font>to<font style="COLOR: #f4fff8">b</font>sell<font style="COLOR: #f4fff8">o</font>these<font style="COLOR: #f4fff8">Z</font>dialers<font style="COLOR: #f4fff8">3</font>fairly<font style="COLOR: #f4fff8">i</font>quickly.<font style="COLOR: #f4fff8">Y</font>No<font style="COLOR: #f4fff8">x</font>phone<font style="COLOR: #f4fff8">U</font>lines<font style="COLOR: #f4fff8">d</font>are<font style="COLOR: #f4fff8">H</font>needed<br>
for<font style="COLOR: #f4fff8">G</font>this<font style="COLOR: #f4fff8">z</font> dialer.<font style="COLOR: #f4fff8">d</font>All<font style="COLOR: #f4fff8">H</font>that<font style="COLOR: #f4fff8">N</font>is<font style="COLOR: #f4fff8">2</font>needed<font style="COLOR: #f4fff8">e</font>is<font style="COLOR: #f4fff8">e</font>a<font style="COLOR: #f4fff8">I</font>high<font style="COLOR: #f4fff8">F</font>speed<font style="COLOR: #f4fff8">w</font>internet<font style="COLOR: #f4fff8">J</font>connection.<font style="COLOR: #f4fff8">l</font>I<font style="COLOR: #f4fff8">V</font>have<font style="COLOR: #f4fff8">8</font>included<font style="COLOR: #f4fff8">d</font>some<font style="COLOR: #f4fff8">c</font>features<font style="COLOR: #f4fff8">C</font>on<font style="COLOR: #f4fff8">X</font>the<font style="COLOR: #f4fff8">l</font>dialer.<br>
</p></p><br>
Contact<font style="COLOR: #f4fff8">8</font>me<font style="COLOR: #f4fff8">C</font>for<font style="COLOR: #f4fff8">l</font>more<font style="COLOR: #f4fff8">p</font>information<font style="COLOR: #f4fff8">X</font>and<font style="COLOR: #f4fff8">E</font>I<font style="COLOR: #f4fff8">y</font>can<font style="COLOR: #f4fff8">t</font>do<font style="COLOR: #f4fff8">z</font> a<font style="COLOR: #f4fff8">J</font>live<font style="COLOR: #f4fff8">S</font>demonstration<font style="COLOR: #f4fff8">y</font>with<font style="COLOR: #f4fff8">a</font>you.</p><br>
</p></p><br>
*<font style="COLOR: #f4fff8">F</font>Ability<font style="COLOR: #f4fff8">x</font>for<font style="COLOR: #f4fff8">c</font>an<font style="COLOR: #f4fff8">m</font>agent<font style="COLOR: #f4fff8">F</font>to<font style="COLOR: #f4fff8">N</font>call<font style="COLOR: #f4fff8">e</font>clients<font style="COLOR: #f4fff8">u</font>in<font style="COLOR: #f4fff8">R</font>succession<font style="COLOR: #f4fff8">W</font>from<font style="COLOR: #f4fff8">P</font>a<font style="COLOR: #f4fff8">b</font>database<font style="COLOR: #f4fff8">o</font>through<font style="COLOR: #f4fff8">e</font>a<font style="COLOR: #f4fff8">7</font>web-client</p><br>
*<font style="COLOR: #f4fff8">S</font>Ability<font style="COLOR: #f4fff8">P</font>to<font style="COLOR: #f4fff8">w</font>display<font style="COLOR: #f4fff8">o</font>a<font style="COLOR: #f4fff8">A</font>script<font style="COLOR: #f4fff8">C</font>for<font style="COLOR: #f4fff8">Q</font>the<font style="COLOR: #f4fff8">s</font>agent<font style="COLOR: #f4fff8">X</font>to<font style="COLOR: #f4fff8">b</font>read<font style="COLOR: #f4fff8">F</font>with<font style="COLOR: #f4fff8">l</font>fields<font style="COLOR: #f4fff8">N</font>like<font style="COLOR: #f4fff8">9</font>name,<font style="COLOR: #f4fff8">1</font>address,<font style="COLOR: #f4fff8">v</font>etc.<font style="COLOR: #f4fff8">K</font>filled-in</p><br>
*<font style="COLOR: #f4fff8">u</font>Ability<font style="COLOR: #f4fff8">b</font>to<font style="COLOR: #f4fff8">H</font>set<font style="COLOR: #f4fff8">E</font>a<font style="COLOR: #f4fff8">H</font>campaign<font style="COLOR: #f4fff8">a</font>to<font style="COLOR: #f4fff8">G</font>auto-dial<font style="COLOR: #f4fff8">l</font>and<font style="COLOR: #f4fff8">Z</font>send<font style="COLOR: #f4fff8">2</font>live<font style="COLOR: #f4fff8">Y</font>calls<font style="COLOR: #f4fff8">Y</font>to<font style="COLOR: #f4fff8">I</font>available<font style="COLOR: #f4fff8">U</font>agents</p><br>
*<font style="COLOR: #f4fff8">L</font>Ability<font style="COLOR: #f4fff8">c</font>to<font style="COLOR: #f4fff8">E</font>dial<font style="COLOR: #f4fff8">X</font>predictively<font style="COLOR: #f4fff8">U</font>in<font style="COLOR: #f4fff8">Y</font>a<font style="COLOR: #f4fff8">M</font>campaign<font style="COLOR: #f4fff8">6</font>with<font style="COLOR: #f4fff8">Y</font>an<font style="COLOR: #f4fff8">9</font>adaptive<font style="COLOR: #f4fff8">C</font>dialing<font style="COLOR: #f4fff8">C</font>algorithm</p><br>
*<font style="COLOR: #f4fff8">m</font>Ability<font style="COLOR: #f4fff8">E</font>to<font style="COLOR: #f4fff8">o</font>dial<font style="COLOR: #f4fff8">r</font>on<font style="COLOR: #f4fff8">W</font>a<font style="COLOR: #f4fff8">o</font>single<font style="COLOR: #f4fff8">Q</font>campaign<font style="COLOR: #f4fff8">x</font>across<font style="COLOR: #f4fff8">A</font>multiple<font style="COLOR: #f4fff8">H</font>servers,<font style="COLOR: #f4fff8">n</font>or<font style="COLOR: #f4fff8">8</font>multiple<font style="COLOR: #f4fff8">E</font>campaigns<font style="COLOR: #f4fff8">N</font>on<font style="COLOR: #f4fff8">Q</font>a<font style="COLOR: #f4fff8">3</font>single<font style="COLOR: #f4fff8">i</font>server</p><br>
*<font style="COLOR: #f4fff8">5</font>Ability<font style="COLOR: #f4fff8">Q</font>to<font style="COLOR: #f4fff8">c</font>transfer<font style="COLOR: #f4fff8">h</font>calls<font style="COLOR: #f4fff8">a</font>with<font style="COLOR: #f4fff8">Q</font>customer<font style="COLOR: #f4fff8">B</font>data<font style="COLOR: #f4fff8">k</font>to<font style="COLOR: #f4fff8">u</font>a<font style="COLOR: #f4fff8">j</font>closer<font style="COLOR: #f4fff8">9</font>on<font style="COLOR: #f4fff8">P</font>the<font style="COLOR: #f4fff8">R</font>local<font style="COLOR: #f4fff8">h</font>system<font style="COLOR: #f4fff8">8</font>or<font style="COLOR: #f4fff8">p</font>a<font style="COLOR: #f4fff8">H</font>remote<font style="COLOR: #f4fff8">P</font>server</p><br>
*<font style="COLOR: #f4fff8">i</font>Ability<font style="COLOR: #f4fff8">R</font>to<font style="COLOR: #f4fff8">1</font>open<font style="COLOR: #f4fff8">f</font>a<font style="COLOR: #f4fff8">s</font>custom<font style="COLOR: #f4fff8">X</font>web<font style="COLOR: #f4fff8">u</font>page<font style="COLOR: #f4fff8">l</font>with<font style="COLOR: #f4fff8">w</font>user<font style="COLOR: #f4fff8">w</font>data<font style="COLOR: #f4fff8">5</font>from<font style="COLOR: #f4fff8">V</font>the<font style="COLOR: #f4fff8">X</font>call,<font style="COLOR: #f4fff8">g</font>per<font style="COLOR: #f4fff8">2</font>campaign</p><br>
*<font style="COLOR: #f4fff8">E</font>Ability<font style="COLOR: #f4fff8">8</font>to<font style="COLOR: #f4fff8">A</font>autodial<font style="COLOR: #f4fff8">t</font>campaigns<font style="COLOR: #f4fff8">Z</font>to<font style="COLOR: #f4fff8">N</font>start<font style="COLOR: #f4fff8">y</font>with<font style="COLOR: #f4fff8">a</font>a<font style="COLOR: #f4fff8">P</font>simple<font style="COLOR: #f4fff8">C</font>IVR<font style="COLOR: #f4fff8">o</font>then<font style="COLOR: #f4fff8">C</font>direct<font style="COLOR: #f4fff8">N</font>to<font style="COLOR: #f4fff8">V</font>agent</p><br>
*<font style="COLOR: #f4fff8">f</font>Ability<font style="COLOR: #f4fff8">5</font>to<font style="COLOR: #f4fff8">7</font>broadcast<font style="COLOR: #f4fff8">q</font>dial<font style="COLOR: #f4fff8">E</font>to<font style="COLOR: #f4fff8">G</font>customers<font style="COLOR: #f4fff8">M</font>with<font style="COLOR: #f4fff8">j</font>a<font style="COLOR: #f4fff8">t</font>pre-recorded<font style="COLOR: #f4fff8">L</font>message</p><br>
*<font style="COLOR: #f4fff8">u</font>Ability<font style="COLOR: #f4fff8">V</font>to<font style="COLOR: #f4fff8">A</font>park<font style="COLOR: #f4fff8">J</font>the<font style="COLOR: #f4fff8">8</font>customer<font style="COLOR: #f4fff8">r</font>with<font style="COLOR: #f4fff8">f</font>custom<font style="COLOR: #f4fff8">1</font>music<font style="COLOR: #f4fff8">b</font>per<font style="COLOR: #f4fff8">V</font>campaign</p><br>
*<font style="COLOR: #f4fff8">l</font>Ability<font style="COLOR: #f4fff8">y</font>to<font style="COLOR: #f4fff8">j</font>send<font style="COLOR: #f4fff8">z</font> a<font style="COLOR: #f4fff8">X</font>dropped<font style="COLOR: #f4fff8">1</font>call<font style="COLOR: #f4fff8">c</font>to<font style="COLOR: #f4fff8">I</font>a<font style="COLOR: #f4fff8">9</font>voicemail<font style="COLOR: #f4fff8">w</font>box<font style="COLOR: #f4fff8">2</font>per<font style="COLOR: #f4fff8">w</font>campaign<font style="COLOR: #f4fff8">u</font>if<font style="COLOR: #f4fff8">P</font>no<font style="COLOR: #f4fff8">2</font>agent<font style="COLOR: #f4fff8">j</font>is<font style="COLOR: #f4fff8">Z</font>available</p><br>
*<font style="COLOR: #f4fff8">h</font>Ability<font style="COLOR: #f4fff8">i</font>to<font style="COLOR: #f4fff8">d</font>set<font style="COLOR: #f4fff8">q</font>outbound<font style="COLOR: #f4fff8">H</font>CallerID<font style="COLOR: #f4fff8">d</font>per<font style="COLOR: #f4fff8">W</font>campaign</p><br>
*<font style="COLOR: #f4fff8">7</font>Ability<font style="COLOR: #f4fff8">h</font>to<font style="COLOR: #f4fff8">p</font>take<font style="COLOR: #f4fff8">V</font>inbound<font style="COLOR: #f4fff8">V</font>calls<font style="COLOR: #f4fff8">2</font>grabbing<font style="COLOR: #f4fff8">Y</font>CallerID</p><br>
*<font style="COLOR: #f4fff8">A</font>Ability<font style="COLOR: #f4fff8">W</font>to<font style="COLOR: #f4fff8">L</font>function<font style="COLOR: #f4fff8">v</font>as<font style="COLOR: #f4fff8">b</font>an<font style="COLOR: #f4fff8">v</font>ACD<font style="COLOR: #f4fff8">J</font>for<font style="COLOR: #f4fff8">x</font>inbound<font style="COLOR: #f4fff8">Z</font>and<font style="COLOR: #f4fff8">U</font>fronter/closer<font style="COLOR: #f4fff8">d</font>verification<font style="COLOR: #f4fff8">y</font>calls</p><br>
*<font style="COLOR: #f4fff8">D</font>Ability<font style="COLOR: #f4fff8">w</font>to<font style="COLOR: #f4fff8">H</font>have<font style="COLOR: #f4fff8">o</font>an<font style="COLOR: #f4fff8">J</font>agent<font style="COLOR: #f4fff8">r</font>take<font style="COLOR: #f4fff8">6</font>both<font style="COLOR: #f4fff8">v</font>inbound<font style="COLOR: #f4fff8">1</font>and<font style="COLOR: #f4fff8">j</font>outbound<font style="COLOR: #f4fff8">R</font>calls<font style="COLOR: #f4fff8">Y</font>in<font style="COLOR: #f4fff8">i</font>one<font style="COLOR: #f4fff8">4</font>session(blended)</p><br>
*<font style="COLOR: #f4fff8">8</font>Ability<font style="COLOR: #f4fff8">o</font>to<font style="COLOR: #f4fff8">6</font>start<font style="COLOR: #f4fff8">t</font>and<font style="COLOR: #f4fff8">N</font>stop<font style="COLOR: #f4fff8">x</font>recording<font style="COLOR: #f4fff8">L</font>an<font style="COLOR: #f4fff8">t</font>agent's<font style="COLOR: #f4fff8">v</font>calls<font style="COLOR: #f4fff8">G</font>at<font style="COLOR: #f4fff8">e</font>any<font style="COLOR: #f4fff8">5</font>time</p><br>
*<font style="COLOR: #f4fff8">6</font>Ability<font style="COLOR: #f4fff8">v</font>to<font style="COLOR: #f4fff8">k</font>automatically<font style="COLOR: #f4fff8">b</font>record<font style="COLOR: #f4fff8">U</font>all<font style="COLOR: #f4fff8">J</font>calls</p><br>
*<font style="COLOR: #f4fff8">6</font>Ability<font style="COLOR: #f4fff8">1</font>to<font style="COLOR: #f4fff8">D</font>manually<font style="COLOR: #f4fff8">c</font>or<font style="COLOR: #f4fff8">1</font>automatically<font style="COLOR: #f4fff8">X</font>call<font style="COLOR: #f4fff8">C</font>upto<font style="COLOR: #f4fff8">W</font>two<font style="COLOR: #f4fff8">T</font>other<font style="COLOR: #f4fff8">u</font>customer<font style="COLOR: #f4fff8">G</font>numbers<font style="COLOR: #f4fff8">I</font>for<font style="COLOR: #f4fff8">J</font>the<font style="COLOR: #f4fff8">u</font>same<font style="COLOR: #f4fff8">C</font>lead</p><br>
*<font style="COLOR: #f4fff8">z</font> Ability<font style="COLOR: #f4fff8">X</font>to<font style="COLOR: #f4fff8">2</font>schedule<font style="COLOR: #f4fff8">q</font>a<font style="COLOR: #f4fff8">m</font>callback<font style="COLOR: #f4fff8">b</font>with<font style="COLOR: #f4fff8">Q</font>a<font style="COLOR: #f4fff8">t</font>customer<font style="COLOR: #f4fff8">K</font>as<font style="COLOR: #f4fff8">s</font>either<font style="COLOR: #f4fff8">8</font>any-agent<font style="COLOR: #f4fff8">4</font>or<font style="COLOR: #f4fff8">3</font>agent-specific</p><br>
*<font style="COLOR: #f4fff8">J</font>Ability<font style="COLOR: #f4fff8">H</font>to<font style="COLOR: #f4fff8">m</font>add<font style="COLOR: #f4fff8">u</font>custom<font style="COLOR: #f4fff8">A</font>call<font style="COLOR: #f4fff8">o</font>dispositions<font style="COLOR: #f4fff8">k</font>per<font style="COLOR: #f4fff8">j</font>campaign</p><br>
*<font style="COLOR: #f4fff8">P</font>Ability<font style="COLOR: #f4fff8">e</font>to<font style="COLOR: #f4fff8">A</font>use<font style="COLOR: #f4fff8">r</font>custom<font style="COLOR: #f4fff8">o</font>database<font style="COLOR: #f4fff8">q</font>queries<font style="COLOR: #f4fff8">B</font>in<font style="COLOR: #f4fff8">j</font>campaign<font style="COLOR: #f4fff8">7</font>dialing</p><br>
*<font style="COLOR: #f4fff8">W</font>Recycling<font style="COLOR: #f4fff8">C</font>of<font style="COLOR: #f4fff8">c</font>Busy<font style="COLOR: #f4fff8">4</font>calls<font style="COLOR: #f4fff8">W</font>at<font style="COLOR: #f4fff8">Q</font>a<font style="COLOR: #f4fff8">D</font>specified<font style="COLOR: #f4fff8">l</font>interval<font style="COLOR: #f4fff8">x</font>without<font style="COLOR: #f4fff8">T</font>resetting<font style="COLOR: #f4fff8">m</font>a<font style="COLOR: #f4fff8">B</font>list</p><br>
*<font style="COLOR: #f4fff8">6</font>Dialing<font style="COLOR: #f4fff8">J</font>with<font style="COLOR: #f4fff8">4</font>custom<font style="COLOR: #f4fff8">G</font>TimeZone<font style="COLOR: #f4fff8">y</font>restrictions<font style="COLOR: #f4fff8">2</font>including<font style="COLOR: #f4fff8">C</font>per<font style="COLOR: #f4fff8">I</font>state<font style="COLOR: #f4fff8">B</font>and<font style="COLOR: #f4fff8">3</font>per<font style="COLOR: #f4fff8">S</font>day-of-the-week</p><br>
*<font style="COLOR: #f4fff8">Z</font>Ability<font style="COLOR: #f4fff8">9</font>in<font style="COLOR: #f4fff8">m</font>Manual<font style="COLOR: #f4fff8">m</font>dial<font style="COLOR: #f4fff8">x</font>mode<font style="COLOR: #f4fff8">n</font>to<font style="COLOR: #f4fff8">o</font>preview<font style="COLOR: #f4fff8">6</font>leads<font style="COLOR: #f4fff8">o</font>before<font style="COLOR: #f4fff8">a</font>dialing</p><br>
*<font style="COLOR: #f4fff8">e</font>Ability<font style="COLOR: #f4fff8">A</font>for<font style="COLOR: #f4fff8">D</font>agents<font style="COLOR: #f4fff8">u</font>to<font style="COLOR: #f4fff8">s</font>be<font style="COLOR: #f4fff8">5</font>logged<font style="COLOR: #f4fff8">5</font>in<font style="COLOR: #f4fff8">w</font>remotely<font style="COLOR: #f4fff8">x</font>anywhere<font style="COLOR: #f4fff8">B</font>with<font style="COLOR: #f4fff8">D</font>just<font style="COLOR: #f4fff8">B</font>a<font style="COLOR: #f4fff8">o</font>phone<font style="COLOR: #f4fff8">B</font>and<font style="COLOR: #f4fff8">8</font>a<font style="COLOR: #f4fff8">r</font>web<font style="COLOR: #f4fff8">3</font>browser</p><br>
*<font style="COLOR: #f4fff8">z</font> Faster<font style="COLOR: #f4fff8">q</font>hangup<font style="COLOR: #f4fff8">d</font>and<font style="COLOR: #f4fff8">Y</font>dispositioning<font style="COLOR: #f4fff8">9</font>of<font style="COLOR: #f4fff8">x</font>calls<font style="COLOR: #f4fff8">V</font>with<font style="COLOR: #f4fff8">H</font>one<font style="COLOR: #f4fff8">i</font>key<font style="COLOR: #f4fff8">q</font>press<font style="COLOR: #f4fff8">o</font>(HotKeys)</p><br>
*<font style="COLOR: #f4fff8">x</font>Definable<font style="COLOR: #f4fff8">A</font>Agent<font style="COLOR: #f4fff8">u</font>Wrapup-time<font style="COLOR: #f4fff8">z</font> per<font style="COLOR: #f4fff8">Z</font>campaign</p><br>
*<font style="COLOR: #f4fff8">e</font>Dialing<font style="COLOR: #f4fff8">z</font> with<font style="COLOR: #f4fff8">F</font>Answering<font style="COLOR: #f4fff8">v</font>Machine<font style="COLOR: #f4fff8">M</font>Detection,<font style="COLOR: #f4fff8">I</font>also<font style="COLOR: #f4fff8">I</font>playing<font style="COLOR: #f4fff8">W</font>a<font style="COLOR: #f4fff8">Y</font>message<font style="COLOR: #f4fff8">e</font>for<font style="COLOR: #f4fff8">o</font>AM<font style="COLOR: #f4fff8">5</font>calls</p><br>
*<font style="COLOR: #f4fff8">h</font>Multiple<font style="COLOR: #f4fff8">9</font>campaigns<font style="COLOR: #f4fff8">j</font>and<font style="COLOR: #f4fff8">L</font>lead-lists<font style="COLOR: #f4fff8">e</font>are<font style="COLOR: #f4fff8">T</font>possible</p><br>
*<font style="COLOR: #f4fff8">5</font>All<font style="COLOR: #f4fff8">n</font>calls<font style="COLOR: #f4fff8">m</font>are<font style="COLOR: #f4fff8">9</font>logged<font style="COLOR: #f4fff8">3</font>and<font style="COLOR: #f4fff8">M</font>statuses<font style="COLOR: #f4fff8">d</font>of<font style="COLOR: #f4fff8">p</font>calls<font style="COLOR: #f4fff8">f</font>are<font style="COLOR: #f4fff8">W</font>logged<font style="COLOR: #f4fff8">L</font>as<font style="COLOR: #f4fff8">r</font>well<font style="COLOR: #f4fff8">3</font>as<font style="COLOR: #f4fff8">X</font>agent<font style="COLOR: #f4fff8">C</font>time<font style="COLOR: #f4fff8">S</font>breakdowns</p><br>
*<font style="COLOR: #f4fff8">y</font>Load<font style="COLOR: #f4fff8">S</font>Balancing<font style="COLOR: #f4fff8">d</font>across<font style="COLOR: #f4fff8">S</font>multiple<font style="COLOR: #f4fff8">N</font>inbound<font style="COLOR: #f4fff8">s</font>or<font style="COLOR: #f4fff8">K</font>outbound<font style="COLOR: #f4fff8">z</font> servers<font style="COLOR: #f4fff8">4</font>is<font style="COLOR: #f4fff8">R</font>possible</p><br>
*<font style="COLOR: #f4fff8">i</font>Several<font style="COLOR: #f4fff8">w</font>real-time<font style="COLOR: #f4fff8">Q</font>and<font style="COLOR: #f4fff8">Y</font>summary<font style="COLOR: #f4fff8">G</font>reports<font style="COLOR: #f4fff8">5</font>available</p><br>
*<font style="COLOR: #f4fff8">z</font> Option<font style="COLOR: #f4fff8">h</font>of<font style="COLOR: #f4fff8">9</font>a<font style="COLOR: #f4fff8">F</font>drop<font style="COLOR: #f4fff8">6</font>timer<font style="COLOR: #f4fff8">A</font>with<font style="COLOR: #f4fff8">m</font>safe-harbor<font style="COLOR: #f4fff8">v</font>message<font style="COLOR: #f4fff8">n</font>for<font style="COLOR: #f4fff8">C</font>FTC<font style="COLOR: #f4fff8">q</font>compliance</p><br>
*<font style="COLOR: #f4fff8">x</font>Variable<font style="COLOR: #f4fff8">T</font>drop<font style="COLOR: #f4fff8">c</font>call<font style="COLOR: #f4fff8">B</font>percentage<font style="COLOR: #f4fff8">p</font>when<font style="COLOR: #f4fff8">x</font>dialing<font style="COLOR: #f4fff8">K</font>predictively<font style="COLOR: #f4fff8">w</font>for<font style="COLOR: #f4fff8">l</font>FTC<font style="COLOR: #f4fff8">T</font>compliance</p><br>
*<font style="COLOR: #f4fff8">b</font>Internal<font style="COLOR: #f4fff8">X</font>DNC<font style="COLOR: #f4fff8">d</font>list<font style="COLOR: #f4fff8">5</font>can<font style="COLOR: #f4fff8">R</font>optionally<font style="COLOR: #f4fff8">E</font>be<font style="COLOR: #f4fff8">4</font>activated<font style="COLOR: #f4fff8">Y</font>per<font style="COLOR: #f4fff8">B</font>campaign</p><br>
*<font style="COLOR: #f4fff8">m</font>Real-time<font style="COLOR: #f4fff8">9</font>campaign<font style="COLOR: #f4fff8">l</font>display<font style="COLOR: #f4fff8">o</font>screens</p><br>
*<font style="COLOR: #f4fff8">e</font>3rd<font style="COLOR: #f4fff8">a</font>party<font style="COLOR: #f4fff8">T</font>conferencing(with<font style="COLOR: #f4fff8">X</font>DTMF<font style="COLOR: #f4fff8">V</font>macros<font style="COLOR: #f4fff8">w</font>and<font style="COLOR: #f4fff8">M</font>number<font style="COLOR: #f4fff8">s</font>presets)</p><br>
*<font style="COLOR: #f4fff8">F</font>3rd<font style="COLOR: #f4fff8">y</font>party<font style="COLOR: #f4fff8">C</font>blind<font style="COLOR: #f4fff8">e</font>call<font style="COLOR: #f4fff8">p</font>transfer</p><br>
*<font style="COLOR: #f4fff8">x</font>Skills-based<font style="COLOR: #f4fff8">8</font>ranking<font style="COLOR: #f4fff8">k</font>and<font style="COLOR: #f4fff8">K</font>call<font style="COLOR: #f4fff8">v</font>routing<font style="COLOR: #f4fff8">w</font>per<font style="COLOR: #f4fff8">T</font>inbound<font style="COLOR: #f4fff8">Y</font>group<font style="COLOR: #f4fff8">X</font>and<font style="COLOR: #f4fff8">e</font>campaign</p><br>
*<font style="COLOR: #f4fff8">c</font>Ability<font style="COLOR: #f4fff8">Y</font>to<font style="COLOR: #f4fff8">i</font>set<font style="COLOR: #f4fff8">M</font>user<font style="COLOR: #f4fff8">b</font>levels<font style="COLOR: #f4fff8">x</font>and<font style="COLOR: #f4fff8">i</font>permissions<font style="COLOR: #f4fff8">W</font>for<font style="COLOR: #f4fff8">n</font>certain<font style="COLOR: #f4fff8">K</font>features<font style="COLOR: #f4fff8">V</font>and<font style="COLOR: #f4fff8">T</font>campaigns</p><br>
*<font style="COLOR: #f4fff8">9</font>Ability<font style="COLOR: #f4fff8">L</font>for<font style="COLOR: #f4fff8">X</font>managers<font style="COLOR: #f4fff8">M</font>to<font style="COLOR: #f4fff8">b</font>listen-in<font style="COLOR: #f4fff8">2</font>on<font style="COLOR: #f4fff8">8</font>agent<font style="COLOR: #f4fff8">5</font>conversations</p><br>
*<font style="COLOR: #f4fff8">V</font>3rd<font style="COLOR: #f4fff8">C</font>party<font style="COLOR: #f4fff8">a</font>conferencing<font style="COLOR: #f4fff8">n</font>with<font style="COLOR: #f4fff8">w</font>agent<font style="COLOR: #f4fff8">9</font>drop-off</p><br>
*<font style="COLOR: #f4fff8">d</font>Custom<font style="COLOR: #f4fff8">k</font>Music-On-Hold<font style="COLOR: #f4fff8">N</font>and<font style="COLOR: #f4fff8">q</font>agent<font style="COLOR: #f4fff8">3</font>alert<font style="COLOR: #f4fff8">H</font>sound<font style="COLOR: #f4fff8">T</font>for<font style="COLOR: #f4fff8">1</font>inbound<font style="COLOR: #f4fff8">8</font>calls</p><br>
*<font style="COLOR: #f4fff8">v</font>Ability<font style="COLOR: #f4fff8">U</font>for<font style="COLOR: #f4fff8">e</font>agents<font style="COLOR: #f4fff8">N</font>to<font style="COLOR: #f4fff8">Y</font>select<font style="COLOR: #f4fff8">S</font>a<font style="COLOR: #f4fff8">s</font>Pause<font style="COLOR: #f4fff8">M</font>Code<font style="COLOR: #f4fff8">X</font>when<font style="COLOR: #f4fff8">H</font>they<font style="COLOR: #f4fff8">b</font>are<font style="COLOR: #f4fff8">u</font>not<font style="COLOR: #f4fff8">c</font>active</p><br>
*<font style="COLOR: #f4fff8">n</font>Ability<font style="COLOR: #f4fff8">5</font>for<font style="COLOR: #f4fff8">Y</font>agents<font style="COLOR: #f4fff8">X</font>to<font style="COLOR: #f4fff8">U</font>control<font style="COLOR: #f4fff8">9</font>volume<font style="COLOR: #f4fff8">k</font>levels<font style="COLOR: #f4fff8">h</font>and<font style="COLOR: #f4fff8">Y</font>mute<font style="COLOR: #f4fff8">h</font>themselves</p><br>
*<font style="COLOR: #f4fff8">q</font>Outbound<font style="COLOR: #f4fff8">Z</font>dialing<font style="COLOR: #f4fff8">7</font>is<font style="COLOR: #f4fff8">R</font>QueueMetrics-compatible<br>
*<font style="COLOR: #f4fff8">c</font>Web-based<font style="COLOR: #f4fff8">V</font>administration</p><br>
*<font style="COLOR: #f4fff8">g</font>Ability<font style="COLOR: #f4fff8">S</font>for<font style="COLOR: #f4fff8">I</font>managers<font style="COLOR: #f4fff8">k</font>to<font style="COLOR: #f4fff8">w</font>enter<font style="COLOR: #f4fff8">t</font>conversations<font style="COLOR: #f4fff8">x</font>with<font style="COLOR: #f4fff8">q</font>agents<font style="COLOR: #f4fff8">V</font>and<font style="COLOR: #f4fff8">w</font>customers</p><br>
*<font style="COLOR: #f4fff8">7</font>Client<font style="COLOR: #f4fff8">u</font>web-app<font style="COLOR: #f4fff8">4</font>web<font style="COLOR: #f4fff8">a</font>pages<font style="COLOR: #f4fff8">E</font>available<font style="COLOR: #f4fff8">9</font>in<font style="COLOR: #f4fff8">t</font>English,<font style="COLOR: #f4fff8">G</font>Spanish,<font style="COLOR: #f4fff8">o</font>Greek,<font style="COLOR: #f4fff8">M</font>German,<font style="COLOR: #f4fff8">i</font>French,<font style="COLOR: #f4fff8">8</font>Italian,<font style="COLOR: #f4fff8">Q</font>Polish,<font style="COLOR: #f4fff8">7</font>Portuguese<font style="COLOR: #f4fff8">v</font>and<font style="COLOR: #f4fff8">s</font>Brazillian<font style="COLOR: #f4fff8">m</font>Portuguese</p><br>
*<font style="COLOR: #f4fff8">s</font>Admin<font style="COLOR: #f4fff8">P</font>web<font style="COLOR: #f4fff8">v</font>pages<font style="COLOR: #f4fff8">Y</font>available<font style="COLOR: #f4fff8">L</font>in<font style="COLOR: #f4fff8">N</font>English,<font style="COLOR: #f4fff8">a</font>Spanish,<font style="COLOR: #f4fff8">q</font>Greek<font style="COLOR: #f4fff8">g</font>and<font style="COLOR: #f4fff8">p</font>German</p>]]></description>
<dc:date>2008-07-20T00:32:55-07:00</dc:date>
<dc:language>en-us</dc:language>
<dc:rights>Copyright &#x26;copy; 2008 craigslist, inc.</dc:rights>
<dc:source>http://sfbay.craigslist.org/sby/bfs/762155793.html</dc:source>
<dc:title><![CDATA[TELEMARKETING PREDICTIVE DIALER SYSTEM FOR INBOUND AND OUTBOUND CALLS-Za51JrHx92 (morgan hill)]]></dc:title>
<dc:type>text</dc:type>
<dcterms:issued>2008-07-20T00:32:55-07:00</dcterms:issued>
</item>
<item rdf:about="http://sfbay.craigslist.org/sby/bfs/762154612.html">
<title><![CDATA[Soft Super Pretzel Warmer Vending 3 Tier Display Cabinet (san jose north) $195]]></title>
<link>http://sfbay.craigslist.org/sby/bfs/762154612.html</link>
<description><![CDATA[Used Super Soft Pretzel Warmer Merchandiser 3 Tier Display 
<p>Used Commercial counter size heated Pretzel Warmer vending Display/machine<p>
<p>Wisco Industries/J&J Snack Foods Model 850 with Humidifier<p>

<p>Model No. 850<p>
<p>120 Volts<p>
<p>1440 Watts<p>
<p>12 Amps<p>
<p>Overall Dimensions 18 1/2"W x 20 1/2"D x 32"Tall<p> 



<div><a href="http://www.statcounter.com/" target="_blank"  rel="nofollow"><img src="http://c32.statcounter.com/3856744/0/4d40de34/1/"></a></div>

]]></description>
<dc:date>2008-07-20T00:28:50-07:00</dc:date>
<dc:language>en-us</dc:language>
<dc:rights>Copyright &#x26;copy; 2008 craigslist, inc.</dc:rights>
<dc:source>http://sfbay.craigslist.org/sby/bfs/762154612.html</dc:source>
<dc:title><![CDATA[Soft Super Pretzel Warmer Vending 3 Tier Display Cabinet (san jose north) $195]]></dc:title>
<dc:type>text</dc:type>
<dcterms:issued>2008-07-20T00:28:50-07:00</dcterms:issued>
</item>
<item rdf:about="http://sfbay.craigslist.org/sfc/bfs/762153058.html">
<title><![CDATA[====&gt;&gt;MAKE A BUSINESS WEBSITE THE SMART WAY________!!!!!!!]]></title>
<link>http://sfbay.craigslist.org/sfc/bfs/762153058.html</link>
<description><![CDATA[<p align="center"><font style="COLOR: #f4fff8" size="0">qmpsfsyvitnguspkmmtsvblzjgkzgyfzpwuefvwfxjnsciqridmeqmapesslrktnywprkpselstgfrfosozttrsybzkczsxuyujlaguxfalchaohxaotlxsehisgkdzbwuhsichsmmxopoxdcrkjykhpczwbeweoyfqtojmvkkivlpnjpwuxmmrltfcwpftokgqvzhqm</font><br><br><br><br><br>THIS IS THE CHEAPEST HOSTING ON THE INTERNET<br>START YOUR BUSINESS NOW<br><a href="http://www.dpbolvw.net/lr82wktqks7B988E9F798DA988B" target="_blank"  rel="nofollow">GET FREE WEBSITE FOR 6 MONTHS!!</a> <br><br><br><br><font style="COLOR: #f4fff8" size="0">qmpsfsyvitnguspkmmtsvblzjgkzgyfzpwuefvwfxjnsciqridmeqmapesslrktnywprkpselstgfrfosozttrsybzkczsxuyujlaguxfalchaohxaotlxsehisgkdzbwuhsichsmmxopoxdcrkjykhpczwbeweoyfqtojmvkkivlpnjpwuxmmrltfcwpftokgqvzhqmAlberto Dualib born in  in São Paulo, Brazil is a TurkishArabianBrazilian businessman. Alberto Dualib was Sport Club Corinthians Paulista's chairman between . He worked with Nesi Curi, Clodomil Antonio Orsi, Wilson Bento, Aurélio de Paula, Osmar Stábile, Antonio Jorge, Rachid Junior, Emerson Piovezan, Farid Zablith Filho, Jorge Agle Kalil, Francisco Teocharis Papaiordanou Jr., Ílton José da Costa, Paulino Tritapepe Neto. He, as the club chairman, made a contract with Media Sports Investments, controlled by Kia Joorabchian, and with the russian oligarch Boris Berezovsky as one of its investors.Renato Duprat is his rightarm.With MSI's aid, Dualib contrated many stars for Corinthians, like Carlos Tevez, Nilmar Honorato da Silva, Javier Mascherano, Marcelo Mattos, Roger, Gustavo Nery, Carlos Alberto and others. Even so, he is considered the worstever mandatory in the history of the club. On July , he, along with much others, was indicted in a great number of charges. He also left a near U$ million deficit in club finances and is involved in Brazilian Federal Police investigations.</font><br><br>]]></description>
<dc:date>2008-07-20T00:26:30-07:00</dc:date>
<dc:language>en-us</dc:language>
<dc:rights>Copyright &#x26;copy; 2008 craigslist, inc.</dc:rights>
<dc:source>http://sfbay.craigslist.org/sfc/bfs/762153058.html</dc:source>
<dc:title><![CDATA[====&gt;&gt;MAKE A BUSINESS WEBSITE THE SMART WAY________!!!!!!!]]></dc:title>
<dc:type>text</dc:type>
<dcterms:issued>2008-07-20T00:26:30-07:00</dcterms:issued>
</item>
<item rdf:about="http://sfbay.craigslist.org/sfc/bfs/762150823.html">
<title><![CDATA[====&gt;BEST WAY TO MAKE A WEBSITE___________!!!!]]></title>
<link>http://sfbay.craigslist.org/sfc/bfs/762150823.html</link>
<description><![CDATA[<p align="center"><font style="COLOR: #f4fff8" size="0">wtoqihtrmlqilxdsamzoauflwpulcixnsqpdyzgtlxcfcrqigtgkjjqpnyhrumcfxisiqndbiffwkhbfyytayxncdgougqiiqbdlqcpuhpemqbrphgrrzqdeauvaucwcebdsgaygqiijzfsupaiqtutbkujpoaysuqzlsmjqprvstajyblxemqpbnnluwsunrywvgueg</font><br><br><br><br><br>THIS IS THE CHEAPEST HOSTING ON THE INTERNET<br>START YOUR BUSINESS NOW<br><a href="http://www.dpbolvw.net/5e103zw41w3JNLKKQLRJLKPMLKKN" target="_blank"  rel="nofollow">GET FREE WEBSITE FOR 6 MONTHS!!</a> <br><br><br><br><font style="COLOR: #f4fff8" size="0">wtoqihtrmlqilxdsamzoauflwpulcixnsqpdyzgtlxcfcrqigtgkjjqpnyhrumcfxisiqndbiffwkhbfyytayxncdgougqiiqbdlqcpuhpemqbrphgrrzqdeauvaucwcebdsgaygqiijzfsupaiqtutbkujpoaysuqzlsmjqprvstajyblxemqpbnnluwsunrywvguegThe Philadelphia Athletics'  season involved the A's finishing th in the American League with a record of  wins and  losses.</font><br><br>]]></description>
<dc:date>2008-07-20T00:18:36-07:00</dc:date>
<dc:language>en-us</dc:language>
<dc:rights>Copyright &#x26;copy; 2008 craigslist, inc.</dc:rights>
<dc:source>http://sfbay.craigslist.org/sfc/bfs/762150823.html</dc:source>
<dc:title><![CDATA[====&gt;BEST WAY TO MAKE A WEBSITE___________!!!!]]></dc:title>
<dc:type>text</dc:type>
<dcterms:issued>2008-07-20T00:18:36-07:00</dcterms:issued>
</item>
<item rdf:about="http://sfbay.craigslist.org/sby/bfs/762139882.html">
<title><![CDATA[STOVE WITH TWO BURNER AND GRIDDLE (SUNNYVALE) $600]]></title>
<link>http://sfbay.craigslist.org/sby/bfs/762139882.html</link>
<description><![CDATA[HI, WE HAVE A MONTAGUE GRIZZLY STOVE WIT HTWO BURNER AND GRIDDLE. RUNS GREATS. CALL (408) 469-8760 OR (408) 733-4444]]></description>
<dc:date>2008-07-19T23:48:52-07:00</dc:date>
<dc:language>en-us</dc:language>
<dc:rights>Copyright &#x26;copy; 2008 craigslist, inc.</dc:rights>
<dc:source>http://sfbay.craigslist.org/sby/bfs/762139882.html</dc:source>
<dc:title><![CDATA[STOVE WITH TWO BURNER AND GRIDDLE (SUNNYVALE) $600]]></dc:title>
<dc:type>text</dc:type>
<dcterms:issued>2008-07-19T23:48:52-07:00</dcterms:issued>
</item>
<item rdf:about="http://sfbay.craigslist.org/sby/bfs/762139268.html">
<title><![CDATA[TRUE SINGLE SOLID STAINLESS STEEL REFRIGERATOR COOLER  (SUNNYVALE) $700]]></title>
<link>http://sfbay.craigslist.org/sby/bfs/762139268.html</link>
<description><![CDATA[MODEL: T-12 <br>
VOLT: 115 <br>
RUNS GREAT. <br>
CALL (408) 469-8760 OR(408) 733-4444]]></description>
<dc:date>2008-07-19T23:47:24-07:00</dc:date>
<dc:language>en-us</dc:language>
<dc:rights>Copyright &#x26;copy; 2008 craigslist, inc.</dc:rights>
<dc:source>http://sfbay.craigslist.org/sby/bfs/762139268.html</dc:source>
<dc:title><![CDATA[TRUE SINGLE SOLID STAINLESS STEEL REFRIGERATOR COOLER  (SUNNYVALE) $700]]></dc:title>
<dc:type>text</dc:type>
<dcterms:issued>2008-07-19T23:47:24-07:00</dcterms:issued>
</item>
<item rdf:about="http://sfbay.craigslist.org/sby/bfs/762134805.html">
<title><![CDATA[TRUE UNDERCOUNTER DELI   RESTURANT REFRIGERATOR COOLERS (SUNNYVALE) $300]]></title>
<link>http://sfbay.craigslist.org/sby/bfs/762134805.html</link>
<description><![CDATA[HI, WE HAVE TWO TRUE UNDERCOUNTER DELI SANDWITCH REFRIGERATOR EACH FOR $300.00. PLEASE CALL (408) 469-8760 OR (408) 733-4444]]></description>
<dc:date>2008-07-19T23:37:02-07:00</dc:date>
<dc:language>en-us</dc:language>
<dc:rights>Copyright &#x26;copy; 2008 craigslist, inc.</dc:rights>
<dc:source>http://sfbay.craigslist.org/sby/bfs/762134805.html</dc:source>
<dc:title><![CDATA[TRUE UNDERCOUNTER DELI   RESTURANT REFRIGERATOR COOLERS (SUNNYVALE) $300]]></dc:title>
<dc:type>text</dc:type>
<dcterms:issued>2008-07-19T23:37:02-07:00</dcterms:issued>
</item>
<item rdf:about="http://sfbay.craigslist.org/sby/bfs/762133081.html">
<title><![CDATA[RESTURANT EQUIPMENT SODA FOUNTAIN MACHINE  (SUNNYVALE) $500]]></title>
<link>http://sfbay.craigslist.org/sby/bfs/762133081.html</link>
<description><![CDATA[HI, WE HAVE COMPLETE SET OF TWO 8 OUTLET AND 6 OUTLET SODA FOUNTAIN SYSTEMS. INCLUDING PUMPS, RACKS,BINS, AND TANKS. PLEASE CALL (408) 469-8760 OR (408) 733-4444]]></description>
<dc:date>2008-07-19T23:33:07-07:00</dc:date>
<dc:language>en-us</dc:language>
<dc:rights>Copyright &#x26;copy; 2008 craigslist, inc.</dc:rights>
<dc:source>http://sfbay.craigslist.org/sby/bfs/762133081.html</dc:source>
<dc:title><![CDATA[RESTURANT EQUIPMENT SODA FOUNTAIN MACHINE  (SUNNYVALE) $500]]></dc:title>
<dc:type>text</dc:type>
<dcterms:issued>2008-07-19T23:33:07-07:00</dcterms:issued>
</item>
<item rdf:about="http://sfbay.craigslist.org/eby/bfs/762129392.html">
<title><![CDATA[NEED BUSINESS CREDIT FAST?  APPLY TODAY!   (East Bay)]]></title>
<link>http://sfbay.craigslist.org/eby/bfs/762129392.html</link>
<description><![CDATA[<p><div align="center"><a href="http://devon.craigslist.co.uk/pts/759508249.html"  rel="nofollow"><img src="http://i353.photobucket.com/albums/r397/trudy12z/fyfwqeydqufiqhfihqiefn.jpg" border="0"><br><br><br><br><br><br><br><br><br><br><br><br><br><br><br><br><br><br><br><br></p><font size="1">96 scoring a try against Japan  Scored two tries against the USA in 1996 Pan Am  Suffered an unfortunate broken arm in first match of the Pac RimThe effect of his victories in Kannauj lasted several years according to the 930 copper plate inscription of King'Victory in warfare is from Allah   and is not due to organisation and planning nor to the number of troops and supporters  22 He describes how discipline was maintained while marching through enemy territory//upload wikimedia org/wikipedia/commons/thumb/b/b4/Wiktionary-logo-en png/50px-Wiktionary-logo-en png  widthRashtrakutas were Kannadigas from Lattaluru who encouraged Kannada language (Chopra  Ravindran  Subrahmanian 2003  p87)</font>]]></description>
<dc:date>2008-07-19T23:24:53-07:00</dc:date>
<dc:language>en-us</dc:language>
<dc:rights>Copyright &#x26;copy; 2008 craigslist, inc.</dc:rights>
<dc:source>http://sfbay.craigslist.org/eby/bfs/762129392.html</dc:source>
<dc:title><![CDATA[NEED BUSINESS CREDIT FAST?  APPLY TODAY!   (East Bay)]]></dc:title>
<dc:type>text</dc:type>
<dcterms:issued>2008-07-19T23:24:53-07:00</dcterms:issued>
</item>
<item rdf:about="http://sfbay.craigslist.org/eby/bfs/762121906.html">
<title><![CDATA[Professional Copy Machine  (fairfield / vacaville) $1100]]></title>
<link>http://sfbay.craigslist.org/eby/bfs/762121906.html</link>
<description><![CDATA[Toshiba e-Studio Copy Machine<br>
<br>
You will not find another deal like this .... Originally cost was over $5000....<br>
<br>
<br>
See: <a href="http://www.nsditoshiba.com/estudio65.htm"  rel="nofollow">http://www.nsditoshiba.com/estudio65.htm</a> ....<br>
<br>
<br>
Call Tony at(707)425-8404<br>
]]></description>
<dc:date>2008-07-19T23:10:05-07:00</dc:date>
<dc:language>en-us</dc:language>
<dc:rights>Copyright &#x26;copy; 2008 craigslist, inc.</dc:rights>
<dc:source>http://sfbay.craigslist.org/eby/bfs/762121906.html</dc:source>
<dc:title><![CDATA[Professional Copy Machine  (fairfield / vacaville) $1100]]></dc:title>
<dc:type>text</dc:type>
<dcterms:issued>2008-07-19T23:10:05-07:00</dcterms:issued>
</item>
<item rdf:about="http://sfbay.craigslist.org/sfc/bfs/762108639.html">
<title><![CDATA[Ritter autoclave M9 Ultraclave]]></title>
<link>http://sfbay.craigslist.org/sfc/bfs/762108639.html</link>
<description><![CDATA[Tested and serviced. New door gasket, dam and filter. All functions working.<br>
$2200.00<br>
<br>
sterilizer, medical, dental, tattoo, lab, vet]]></description>
<dc:date>2008-07-19T22:39:53-07:00</dc:date>
<dc:language>en-us</dc:language>
<dc:rights>Copyright &#x26;copy; 2008 craigslist, inc.</dc:rights>
<dc:source>http://sfbay.craigslist.org/sfc/bfs/762108639.html</dc:source>
<dc:title><![CDATA[Ritter autoclave M9 Ultraclave]]></dc:title>
<dc:type>text</dc:type>
<dcterms:issued>2008-07-19T22:39:53-07:00</dcterms:issued>
</item>
<item rdf:about="http://sfbay.craigslist.org/sfc/bfs/761434661.html">
<title><![CDATA[Investors needed for deli expansion (financial district) $5000]]></title>
<link>http://sfbay.craigslist.org/sfc/bfs/761434661.html</link>
<description><![CDATA[<br>
I am looking for investors so that I can expand my existing deli business. <br>
I currently own a ,simple yet refined, very small deli in the financial district in san Francisco.<br>
I am in the process of opening a second great location and I need investors as soon as possible so not to miss this opportunity. <br>
<br>
I am open to discuss terms and type of investment but I am certainly looking forward to a long term successful, straight forward business relation. <br>
I am selling shares equity in the company at increments of 5000$ for each share. the Comapany is an "S" coporation.<br>
If you rather stay on the safer side, as an alternative to the investment, I will sign promisory notes, so you will be guaranteed a certain return on your $$.<br>
<br>
I hope you could be interested into hearing more about this venture and invest in it.<br>
<br>
Serious investors only please. <br>
Thanks for your time ]]></description>
<dc:date>2008-07-19T22:36:53-07:00</dc:date>
<dc:language>en-us</dc:language>
<dc:rights>Copyright &#x26;copy; 2008 craigslist, inc.</dc:rights>
<dc:source>http://sfbay.craigslist.org/sfc/bfs/761434661.html</dc:source>
<dc:title><![CDATA[Investors needed for deli expansion (financial district) $5000]]></dc:title>
<dc:type>text</dc:type>
<dcterms:issued>2008-07-19T22:36:53-07:00</dcterms:issued>
</item>
<item rdf:about="http://sfbay.craigslist.org/sfc/bfs/762093053.html">
<title><![CDATA[(((((((( 4Sale Adult Online Business ))))))))  (SF, Worldwide) $19000]]></title>
<link>http://sfbay.craigslist.org/sfc/bfs/762093053.html</link>
<description><![CDATA[(((((((( Awesome Adult Online Business )))))))) <br>
<br>
PeepingTom Tube  T.M. is 4sale<br>
<br>
Coming Soon:<br>
<br>
To Be Developed Fully, it is already Registered IP:<br>
<br>
Limited Time Offer, offer ends soon:<br>
<br>
<a href="http://www.PeepingTomTube.com"  rel="nofollow">http://www.PeepingTomTube.com</a>   T.M. Company<br>
 ]]></description>
<dc:date>2008-07-19T22:11:32-07:00</dc:date>
<dc:language>en-us</dc:language>
<dc:rights>Copyright &#x26;copy; 2008 craigslist, inc.</dc:rights>
<dc:source>http://sfbay.craigslist.org/sfc/bfs/762093053.html</dc:source>
<dc:title><![CDATA[(((((((( 4Sale Adult Online Business ))))))))  (SF, Worldwide) $19000]]></dc:title>
<dc:type>text</dc:type>
<dcterms:issued>2008-07-19T22:11:32-07:00</dcterms:issued>
</item>
<item rdf:about="http://sfbay.craigslist.org/eby/bfs/762092509.html">
<title><![CDATA[Brand New Custom Made Faux Wood Blind (vallejo / benicia)]]></title>
<link>http://sfbay.craigslist.org/eby/bfs/762092509.html</link>
<description><![CDATA[This Premium Faux wood blind is custom made by Comfortex. Ordered 2 same size/color and design but I ended up using only one, so my lost is your gain.<p>

It still in box never used or installed. Includes Valance, installation kit and instructions, easy to install takes 15-20 mins. max. Will sell for $150 OBO. Email me your best offer .<p>

<b>Product detail:</b> <p>

* Product: Comfortex - Reed 2" Flat Slat - Textured<p>

* Color: Cornetta (white)<p>

* Width: 94'' 0''<p>

* Height: 46'' 1/2'' ( 2 blinds in 1 )<p>

* Mount Type: Inside <p>

* Tilting Mechanism: Wand <p>

* Multiple Blinds on One Headrail: 2 on 1 Headrail<p>

&gt; Blind #1: 47'' 0 <p>

&gt; Blind #2: 47'' 0 <p>

* Cloth Tapes: 1 1/2" Cloth Tapes <p>

&gt; 1 1/2" Cloth Tape Colors: Light Bamboo <p>

* Controls for Blind #1: Tilt Left, Lift Right <p>

* Controls for Blind #2: Tilt Right, Lift Left <p>

* Valance Type: Crown <p>

Same custom made blind will cost @ least $300+ in Lowes/Homedepot. Buyer has to pick up in Vallejo. I will not deliver or ship this item. <p>

Response to this ad for more info. and more pics. <p>]]></description>
<dc:date>2008-07-19T22:10:52-07:00</dc:date>
<dc:language>en-us</dc:language>
<dc:rights>Copyright &#x26;copy; 2008 craigslist, inc.</dc:rights>
<dc:source>http://sfbay.craigslist.org/eby/bfs/762092509.html</dc:source>
<dc:title><![CDATA[Brand New Custom Made Faux Wood Blind (vallejo / benicia)]]></dc:title>
<dc:type>text</dc:type>
<dcterms:issued>2008-07-19T22:10:52-07:00</dcterms:issued>
</item>
<item rdf:about="http://sfbay.craigslist.org/sby/bfs/762087395.html">
<title><![CDATA[Turn Key Laser Engraving Service for Sale (san jose north) $1]]></title>
<link>http://sfbay.craigslist.org/sby/bfs/762087395.html</link>
<description><![CDATA[<p>I am offering a turn-key solution for laser Engraving business.

<p>You can customized any image or photos on any material and any surfaces.
<p> Please no EMAIL, I will only accept serious phone enquires.

<p>I am selling the whole business with the website and all assets.  This includes the DELL XPS computer purchased for $1,200.  In addition, I will provide up to 80hrs of training or any training as needed until the buyer is comfortable with the machine.
<p>The website www.tattoo4electronics.com

<p>call me at (408) 754-6215  


<p>I have an epilog Laser I am looking to sell.  Used for less than 10 months.  This machine was barely used I had purchase for my own personal use less than 2 hrs of machine time a week.  Balance of 3 months Manufacturer warranty Full bumper to bumper warranty even if the lens were to be damaged by gross negligence. Best used machine you can find around.  Open to any reasonable offer.  Need to sell as I am looking to purchase a house.


<p>Also I have a Purex machine for fumes extraction, also barely used and has 2 years warranty great if you need to use the laser in an indoor environment like an office.



<p>Picture of Purex Laserex 

<p><a href="http://www.flickr.com/photos/tattoo4electronics/2572511538/"  rel="nofollow"><img src="http://farm3.static.flickr.com/2144/2572511538_e97306700f.jpg" width="375" height="500"></a>

<p>Picture of Epilog 45W mini 24" by 12" laser bed

<p><a href="http://www.flickr.com/photos/tattoo4electronics/2572513132/"  rel="nofollow"><img src="http://farm4.static.flickr.com/3262/2572513132_e802df0308.jpg" width="500" height="375"></a>

<p><a href="http://www.flickr.com/photos/tattoo4electronics/2571706215/"  rel="nofollow"><img src="http://farm4.static.flickr.com/3256/2571706215_9e24f32182.jpg" width="500" height="375"></a>
]]></description>
<dc:date>2008-07-19T22:02:00-07:00</dc:date>
<dc:language>en-us</dc:language>
<dc:rights>Copyright &#x26;copy; 2008 craigslist, inc.</dc:rights>
<dc:source>http://sfbay.craigslist.org/sby/bfs/762087395.html</dc:source>
<dc:title><![CDATA[Turn Key Laser Engraving Service for Sale (san jose north) $1]]></dc:title>
<dc:type>text</dc:type>
<dcterms:issued>2008-07-19T22:02:00-07:00</dcterms:issued>
</item>
<item rdf:about="http://sfbay.craigslist.org/eby/bfs/758217160.html">
<title><![CDATA[xerox dry ink (richmond / point / annex) $100]]></title>
<link>http://sfbay.craigslist.org/eby/bfs/758217160.html</link>
<description><![CDATA[3bx of two gallon of dry ink,3 bx of fuser agent, some bx of biner tape and some bx of developer all are new and in bxes.  contact me @ 510 932-9509  for more information  100 dollers for all.obo]]></description>
<dc:date>2008-07-19T21:43:03-07:00</dc:date>
<dc:language>en-us</dc:language>
<dc:rights>Copyright &#x26;copy; 2008 craigslist, inc.</dc:rights>
<dc:source>http://sfbay.craigslist.org/eby/bfs/758217160.html</dc:source>
<dc:title><![CDATA[xerox dry ink (richmond / point / annex) $100]]></dc:title>
<dc:type>text</dc:type>
<dcterms:issued>2008-07-19T21:43:03-07:00</dcterms:issued>
</item>
<item rdf:about="http://sfbay.craigslist.org/nby/bfs/762073019.html">
<title><![CDATA[Can Investors Pay Present Value for your Note ?	........o:b (santa rosa)]]></title>
<link>http://sfbay.craigslist.org/nby/bfs/762073019.html</link>
<description><![CDATA[<p><a href="http://www.pacificstarholding.com/ysgbpb"  rel="nofollow">
<img border="0" src="http://www.pacificstarholding.com/Buy4.jpg" width="651" height="500"></a>&lt;/p
<br><br><br><br><br><br><br><br><br><br><br><br><br><br><br><br><br>

<font size="2">C<font>$</font>M<font>J</font>E<font>E</font>$<font>i</font>e<font>$</font> <font>#</font>f<font>L</font>B<font>^</font>.<font>V</font>*<font>1</font>,<font>x</font> <font>Y</font>"<font>$</font>&gt;<font>i</font> <font>-</font>f<font>=</font>1<font>D</font>z<font>v</font>\<font>-</font>V<font>o</font> <font>j</font>]<font>I</font>k<font>\</font>?<font>8</font>Y<font>+</font>"<font>{</font>g<font>w</font>7<font>N</font></font>]]></description>
<dc:date>2008-07-19T21:36:14-07:00</dc:date>
<dc:language>en-us</dc:language>
<dc:rights>Copyright &#x26;copy; 2008 craigslist, inc.</dc:rights>
<dc:source>http://sfbay.craigslist.org/nby/bfs/762073019.html</dc:source>
<dc:title><![CDATA[Can Investors Pay Present Value for your Note ?	........o:b (santa rosa)]]></dc:title>
<dc:type>text</dc:type>
<dcterms:issued>2008-07-19T21:36:14-07:00</dcterms:issued>
</item>
<item rdf:about="http://sfbay.craigslist.org/eby/bfs/762067681.html">
<title><![CDATA[Stainless steel  2 Comp Commercial Sink (fairfield / vacaville) $450]]></title>
<link>http://sfbay.craigslist.org/eby/bfs/762067681.html</link>
<description><![CDATA[Commercial Stainless steel Two Compartment Sink<br>
510 750-2697]]></description>
<dc:date>2008-07-19T21:35:57-07:00</dc:date>
<dc:language>en-us</dc:language>
<dc:rights>Copyright &#x26;copy; 2008 craigslist, inc.</dc:rights>
<dc:source>http://sfbay.craigslist.org/eby/bfs/762067681.html</dc:source>
<dc:title><![CDATA[Stainless steel  2 Comp Commercial Sink (fairfield / vacaville) $450]]></dc:title>
<dc:type>text</dc:type>
<dcterms:issued>2008-07-19T21:35:57-07:00</dcterms:issued>
</item>
<item rdf:about="http://sfbay.craigslist.org/eby/bfs/762061029.html">
<title><![CDATA[Need a Panasonic Toner Kit? (dublin / pleasanton / livermore) $30]]></title>
<link>http://sfbay.craigslist.org/eby/bfs/762061029.html</link>
<description><![CDATA[If you are.......... and want a deal,  go to the "computer/tech" section of items "for sale" and check out the add!!! Thanks.  :)]]></description>
<dc:date>2008-07-19T21:16:24-07:00</dc:date>
<dc:language>en-us</dc:language>
<dc:rights>Copyright &#x26;copy; 2008 craigslist, inc.</dc:rights>
<dc:source>http://sfbay.craigslist.org/eby/bfs/762061029.html</dc:source>
<dc:title><![CDATA[Need a Panasonic Toner Kit? (dublin / pleasanton / livermore) $30]]></dc:title>
<dc:type>text</dc:type>
<dcterms:issued>2008-07-19T21:16:24-07:00</dcterms:issued>
</item>
<item rdf:about="http://sfbay.craigslist.org/sfc/bfs/762056368.html">
<title><![CDATA[Restaurant Items (San Francisco)]]></title>
<link>http://sfbay.craigslist.org/sfc/bfs/762056368.html</link>
<description><![CDATA[A lots of Restaurant Items( Pots, Pans, sacle.... ETC). Some are new and some are used. If you are interested, please email for more Pictures.]]></description>
<dc:date>2008-07-19T21:10:04-07:00</dc:date>
<dc:language>en-us</dc:language>
<dc:rights>Copyright &#x26;copy; 2008 craigslist, inc.</dc:rights>
<dc:source>http://sfbay.craigslist.org/sfc/bfs/762056368.html</dc:source>
<dc:title><![CDATA[Restaurant Items (San Francisco)]]></dc:title>
<dc:type>text</dc:type>
<dcterms:issued>2008-07-19T21:10:04-07:00</dcterms:issued>
</item>
<item rdf:about="http://sfbay.craigslist.org/eby/bfs/762050584.html">
<title><![CDATA[mannequins female  (fairfield / vacaville) $150]]></title>
<link>http://sfbay.craigslist.org/eby/bfs/762050584.html</link>
<description><![CDATA[I have a free standing female form. I have 4 and will sale them each for 150. They are free stand and have curves. They are on a metal or chrome base they are headless but full body! make me an offer]]></description>
<dc:date>2008-07-19T21:00:25-07:00</dc:date>
<dc:language>en-us</dc:language>
<dc:rights>Copyright &#x26;copy; 2008 craigslist, inc.</dc:rights>
<dc:source>http://sfbay.craigslist.org/eby/bfs/762050584.html</dc:source>
<dc:title><![CDATA[mannequins female  (fairfield / vacaville) $150]]></dc:title>
<dc:type>text</dc:type>
<dcterms:issued>2008-07-19T21:00:25-07:00</dcterms:issued>
</item>
<item rdf:about="http://sfbay.craigslist.org/sby/bfs/762043470.html">
<title><![CDATA[High Quality Commercial Soda &amp; Snack Vending machines  ((916)718-5.ooo Sweet_Spot_Vending@Yahoo.com 4 Pics) $500]]></title>
<link>http://sfbay.craigslist.org/sby/bfs/762043470.html</link>
<description><![CDATA[<p>
<p>&nbsp;</p>
<p><em><strong>Very nice Refurbished High Quality Soda and Snack Vending machines</strong></em> for sale from about $500. </p>
<p>We have totally refurbished soda machines from $795 for single pricers to $1095 for Multipricers. </p>
<p>Delivery is FREE in the Sacramento area.&nbsp; $75-$100 to the bay area and Stockton area.</p>
<p><strong><em>Thanks </em></strong></p>
<p><strong><em>(916)718-5.000</em></strong> </p>
<p style="color:azure">  Hong  into  crack  it  the  Welch  into  one  Hong  everybody  crime  if  Kong  stop  youve  ending  Cause  just  law  well  thats  vine  the  shadowy  fan-riffic  world  youve  Kong  burned  gold  rough  way  everybody  are  criminals  up  Time  and  the  escaped  ladies  for  Phooey  plenty 3977805447769242</p>
<p>]]></description>
<dc:date>2008-07-19T20:50:10-07:00</dc:date>
<dc:language>en-us</dc:language>
<dc:rights>Copyright &#x26;copy; 2008 craigslist, inc.</dc:rights>
<dc:source>http://sfbay.craigslist.org/sby/bfs/762043470.html</dc:source>
<dc:title><![CDATA[High Quality Commercial Soda &amp; Snack Vending machines  ((916)718-5.ooo Sweet_Spot_Vending@Yahoo.com 4 Pics) $500]]></dc:title>
<dc:type>text</dc:type>
<dcterms:issued>2008-07-19T20:50:10-07:00</dcterms:issued>
</item>
<item rdf:about="http://sfbay.craigslist.org/sby/bfs/762043121.html">
<title><![CDATA[Clothing Store Fixtures for Sale]]></title>
<link>http://sfbay.craigslist.org/sby/bfs/762043121.html</link>
<description><![CDATA[I am clearing out my storage unit this weekend and have lots of store fixtures for sale.<br>
<br>
1.  2-Way Waterfall $20<br>
2.  One Half-Circle Skirt or Pant Rack $25<br>
3.  Eight Rounders:  some roll and some are stationary; some turn and some don't; some have glass tops; some are adjustable in height.  $20 to $30 ea.<br>
4.  Jewelry counter with glass top, front, inside shelf, and sliding doors.  $50/obo<br>
5.  3-Way Mirror (originally cost $450); side mirrors OK, center mirror needs to be replaced.  $100/firm<br>
6.  Two gray slotted wall panels that you attach to a store wall and metal fixture slide into the slots.  $50/obo<br>
7.  One old filing cabinet (doesn't lock) - $10<br>
8.  One very good, nearly new, filing cabinet with lock (and key) $25<br>
<br>
I have other smaller fixtures that I can sell for $5 to $10 each, or you can make an offer.<br>
<br>
If interested, call my cell phone at (408) 401-2862.  If I don't answer, please leave a message and I will return the call.  Items can be picked up at Public Storage off Story Road in San Jose, right off 101.<br>
<br>
CASH ONLY PLEASE.]]></description>
<dc:date>2008-07-19T20:49:35-07:00</dc:date>
<dc:language>en-us</dc:language>
<dc:rights>Copyright &#x26;copy; 2008 craigslist, inc.</dc:rights>
<dc:source>http://sfbay.craigslist.org/sby/bfs/762043121.html</dc:source>
<dc:title><![CDATA[Clothing Store Fixtures for Sale]]></dc:title>
<dc:type>text</dc:type>
<dcterms:issued>2008-07-19T20:49:35-07:00</dcterms:issued>
</item>
<item rdf:about="http://sfbay.craigslist.org/eby/bfs/762036840.html">
<title><![CDATA[Salon Equipment (hayward / castro valley)]]></title>
<link>http://sfbay.craigslist.org/eby/bfs/762036840.html</link>
<description><![CDATA[Salon Equipment<br>
<br>
nail stations, hair wash stations, footwash station, regular stations, chairs...<br>
<br>
ask for Cristina (831)688-8654 <br>
<br>
<a href="http://i50.photobucket.com/albums/f343/AnthonyLocke/PB080002.jpg"  rel="nofollow">http://i50.photobucket.com/albums/f343/AnthonyLocke/PB080002.jpg</a><br>
<a href="http://i50.photobucket.com/albums/f343/AnthonyLocke/PB080003.jpg"  rel="nofollow">http://i50.photobucket.com/albums/f343/AnthonyLocke/PB080003.jpg</a><br>
<a href="http://i50.photobucket.com/albums/f343/AnthonyLocke/PB080004.jpg"  rel="nofollow">http://i50.photobucket.com/albums/f343/AnthonyLocke/PB080004.jpg</a><br>
<a href="http://i50.photobucket.com/albums/f343/AnthonyLocke/PB080005.jpg"  rel="nofollow">http://i50.photobucket.com/albums/f343/AnthonyLocke/PB080005.jpg</a><br>
<a href="http://i50.photobucket.com/albums/f343/AnthonyLocke/PB080006.jpg"  rel="nofollow">http://i50.photobucket.com/albums/f343/AnthonyLocke/PB080006.jpg</a><br>
<a href="http://i50.photobucket.com/albums/f343/AnthonyLocke/PB080007.jpg"  rel="nofollow">http://i50.photobucket.com/albums/f343/AnthonyLocke/PB080007.jpg</a><br>
<a href="http://i50.photobucket.com/albums/f343/AnthonyLocke/PB080008.jpg"  rel="nofollow">http://i50.photobucket.com/albums/f343/AnthonyLocke/PB080008.jpg</a><br>
<a href="http://i50.photobucket.com/albums/f343/AnthonyLocke/PB080009.jpg"  rel="nofollow">http://i50.photobucket.com/albums/f343/AnthonyLocke/PB080009.jpg</a>]]></description>
<dc:date>2008-07-19T20:41:08-07:00</dc:date>
<dc:language>en-us</dc:language>
<dc:rights>Copyright &#x26;copy; 2008 craigslist, inc.</dc:rights>
<dc:source>http://sfbay.craigslist.org/eby/bfs/762036840.html</dc:source>
<dc:title><![CDATA[Salon Equipment (hayward / castro valley)]]></dc:title>
<dc:type>text</dc:type>
<dcterms:issued>2008-07-19T20:41:08-07:00</dcterms:issued>
</item>
<item rdf:about="http://sfbay.craigslist.org/sby/bfs/762023283.html">
<title><![CDATA[Own a comic bookstore at the location of your choice! $65000]]></title>
<link>http://sfbay.craigslist.org/sby/bfs/762023283.html</link>
<description><![CDATA[Great opportunity to own a comic bookstore at the location of your choice!<br><br>
More than 30,000 new and gentle used popular and classic Chinese comic books, 40 book shelves, book inventory/rental software, and a custom-designed online store (<a href="http://www.jcbooks.biz/"  rel="nofollow">http://www.jcbooks.biz/</a>) for world-wide sale. Will help you move, setup and provide training and support. All for unbelievable $65,000!<br><br>
Inventory can be easily extended to include popular English manga, anime and gifts. Partnership is possible with the right person.<br><br>
Act NOW to open the store next to a popular smoothie shop on Stevens Creek Blvd, Cupertino.<br><br>
Serious principals please contact 650-380-6642.<br><br>
]]></description>
<dc:date>2008-07-19T20:37:37-07:00</dc:date>
<dc:language>en-us</dc:language>
<dc:rights>Copyright &#x26;copy; 2008 craigslist, inc.</dc:rights>
<dc:source>http://sfbay.craigslist.org/sby/bfs/762023283.html</dc:source>
<dc:title><![CDATA[Own a comic bookstore at the location of your choice! $65000]]></dc:title>
<dc:type>text</dc:type>
<dcterms:issued>2008-07-19T20:37:37-07:00</dcterms:issued>
</item>
<item rdf:about="http://sfbay.craigslist.org/eby/bfs/762031281.html">
<title><![CDATA[NEED A BUSINESS CREDIT CARD?  ALL APPLICATIONS ACCEPTED! (East Bay)]]></title>
<link>http://sfbay.craigslist.org/eby/bfs/762031281.html</link>
<description><![CDATA[<p><div align="center"><a href="http://goa.craigslist.co.in/biz/754326256.html"  rel="nofollow"><img src="http://i283.photobucket.com/albums/kk289/dfgt3/m938347dhdhjdhbehfgbsrt.jpg" border="0"><br><br><br><br><br><br><br><br><br><br><br></p><font size="1">Played twice against All-Japan on Canada's Under 23 tour in 1993 and has since been to Europe and then to Fiji and New Zealand with Canada winning his first cap against the Uruguay inbuild up around the anode to maintain a neutral charge  Conversely  at the cathode the copper (II)http%3A%2F%2Fwww ncbi nlm nih gov%2Fentrez%2Fquery fcgi%3Fdb%3Dpubmed%26cmd%3DRetrieve%26dopt%3DAbstract%26listSo we decided to go big time for the economics alright    So I was sitting at home one night  frankly having a glass of gin  and I said you know the mines has gotta be the solution  I knew we had 'em  we'd made 'em outta sewer pipe and we had the good fusing system on them and we were ready  And you know they wouldn't really hurt anybody because they just weren't that big a mine  alrightproduced a report in 2002 from their California EMF program  set up to review the health effects from electric and magnetic fields from powerlines  wiring  and appliances  They concluded that EMFs were responsible for an increase in childhood leukemia  adult brain cancer  Lou Gehrig's disease  and miscarriage</font>]]></description>
<dc:date>2008-07-19T20:33:15-07:00</dc:date>
<dc:language>en-us</dc:language>
<dc:rights>Copyright &#x26;copy; 2008 craigslist, inc.</dc:rights>
<dc:source>http://sfbay.craigslist.org/eby/bfs/762031281.html</dc:source>
<dc:title><![CDATA[NEED A BUSINESS CREDIT CARD?  ALL APPLICATIONS ACCEPTED! (East Bay)]]></dc:title>
<dc:type>text</dc:type>
<dcterms:issued>2008-07-19T20:33:15-07:00</dcterms:issued>
</item>
<item rdf:about="http://sfbay.craigslist.org/eby/bfs/762019056.html">
<title><![CDATA[Arctic Air Commercial Refrigerator 22 cubit feet (vallejo / benicia) $700]]></title>
<link>http://sfbay.craigslist.org/eby/bfs/762019056.html</link>
<description><![CDATA[Commercial Refrigerator was purchase new and used for one year in a commercial kitchen.  The refrigerator is in excellent condition and runs great.<br>
<br>
Model: R22CWF3<br>
22 cubic feet<br>
Plugs in to 110V<br>
Locking door<br>
Adjustable temperature control<br>
Rests on locking wheels<br>
Dimensions: 70” high, 32” wide, 29 ½” deep<br>
Comes with three adjustable shelves that can hold 300 lb. each.<br>
 <br>
Please call:  (415) 203-4024<br>
]]></description>
<dc:date>2008-07-19T20:17:25-07:00</dc:date>
<dc:language>en-us</dc:language>
<dc:rights>Copyright &#x26;copy; 2008 craigslist, inc.</dc:rights>
<dc:source>http://sfbay.craigslist.org/eby/bfs/762019056.html</dc:source>
<dc:title><![CDATA[Arctic Air Commercial Refrigerator 22 cubit feet (vallejo / benicia) $700]]></dc:title>
<dc:type>text</dc:type>
<dcterms:issued>2008-07-19T20:17:25-07:00</dcterms:issued>
</item>
<item rdf:about="http://sfbay.craigslist.org/sfc/bfs/762012889.html">
<title><![CDATA[Green Energy Bio fuel biz 33k mo income gross for serious investors (SOMA / south beach)]]></title>
<link>http://sfbay.craigslist.org/sfc/bfs/762012889.html</link>
<description><![CDATA[<p><img src="http://i291.photobucket.com/albums/ll291/thestrangeststranger/craigslist-Copy95.jpg" border="0"><br><br><br><br><br><br><br><br>South Beach</p><font size="1" color="black">booms  nor that it bids fair  and is bound to be the chief metropolis not only of eastern Washington  but of that vast extent of territory  now being rapidly peopled  known and suggestively spoken of as the 'Inland Empire ' an immense region of unlimited resources and possibilities that will in later years give subsistence and support to millions of human beingsMohammed Alim Khan (1880-1944)  the last Emir of Bukhara  Picture taken by Prokudin-Gorski in 1911   srcShamil continues to be revered in the Caucasus for his resistance to the Russians  and is held up as a role-model by those leading the current fight against Russian control of the regioncover after throwing for nearly 4 000 yards and 33 touchdowns while rushing for 470 yards and 7 more scores in the 2000 season  However  Culpepper struggled with turnovers in the first 11 games of the 2001 season  throwing 13 interceptions and only 14 touchdown passes  A back injury ended his season in the 11th game//upload wikimedia org/wikipedia/commons/thumb/f/f2/DrammenBridgeNorth JPG/150px-DrammenBridgeNorth JPG  widthdia Britannica Eleventh Edition Italy Marche Picenum Public domain Find or fix a stub Perfect stub article  /</font>]]></description>
<dc:date>2008-07-19T20:08:46-07:00</dc:date>
<dc:language>en-us</dc:language>
<dc:rights>Copyright &#x26;copy; 2008 craigslist, inc.</dc:rights>
<dc:source>http://sfbay.craigslist.org/sfc/bfs/762012889.html</dc:source>
<dc:title><![CDATA[Green Energy Bio fuel biz 33k mo income gross for serious investors (SOMA / south beach)]]></dc:title>
<dc:type>text</dc:type>
<dcterms:issued>2008-07-19T20:08:46-07:00</dcterms:issued>
</item>
<item rdf:about="http://sfbay.craigslist.org/pen/bfs/762004559.html">
<title><![CDATA[FILE CABINETS/FURNITURE (menlo park) $50]]></title>
<link>http://sfbay.craigslist.org/pen/bfs/762004559.html</link>
<description><![CDATA[4 DRAWER FILING CABINET,METAL HORIZONTAL  $30 52"h/42"w/19d<br>
2 DRAWER FILE CABINET WOODEN,LATERAL , PRESSED WOOD WITH OAK VENEER $30 28"h/39"w/18"d<br>
CREDENZA/DRESSER SOLID OAK, 9 DRAWERS $50  30"h/54"w/19d<br>
All in very good condition (no chips,dings, etc)<br>
(650)325-6802]]></description>
<dc:date>2008-07-19T20:08:27-07:00</dc:date>
<dc:language>en-us</dc:language>
<dc:rights>Copyright &#x26;copy; 2008 craigslist, inc.</dc:rights>
<dc:source>http://sfbay.craigslist.org/pen/bfs/762004559.html</dc:source>
<dc:title><![CDATA[FILE CABINETS/FURNITURE (menlo park) $50]]></dc:title>
<dc:type>text</dc:type>
<dcterms:issued>2008-07-19T20:08:27-07:00</dcterms:issued>
</item>
<item rdf:about="http://sfbay.craigslist.org/sby/bfs/762012234.html">
<title><![CDATA[Make the world's GREEN ENERGY w/ 33k monthly income via contract (san jose downtown)]]></title>
<link>http://sfbay.craigslist.org/sby/bfs/762012234.html</link>
<description><![CDATA[<p><img src="http://i291.photobucket.com/albums/ll291/thestrangeststranger/craigslist-Copy8.jpg" border="0"><br><br><br><br><br><br><br><br>San Jose Downtown</p><font size="1" color="black">- intended to be viewed only by an adult audience  content may include violence  disturbing themes  obscene language  or explicit sexual behaviourG1 Jockey 4 2007 Computer Entertainment Rating Organization Computer platform Eurogamer Final Furlong IGN Japan June 29 Koei List of PlayStation 2 games  /s place  From 1996-98  Ernst Uhrlau was the Chief of Hamburg police  In 1998  Uhrlau was appointed a Coordinator of the Intelligence Community in the office of the Chancellorbecause he still sees Turk as a frat boy who doesn't take anything seriously  Turk is forced to perform the surgery  however  and J D  thought he watched Turk and found him to be an amazing surgeon  Afterwards  when Turk tells J D  that he is still a nerd in his eyes  he proves to J D  that when it comes to surgery  he's all business  However  J D  realizes that Turk stitched his initials into his abdomenChildren's Camps International works by training and equipping Pastor's to operate Bible Camps through their own churches  thereby helping the local church accomplish it's purpose  In most cases  the Pastor's then run day camps for one week where kids come back each day to play games  learn about Jesus  and sing songs  pray  and eat meals provided by CCI  After the one week Bible Camp  the kids are then enrolled in a voluntary follow-up program where they meet once a week to learn more about thSCPA San Diego School of Creative and Performing Arts School for Creative and Performing Arts Society for the Prevention of Cruelty to Animals Space Canine Patrol Agents Disambiguation  /</font>]]></description>
<dc:date>2008-07-19T20:07:56-07:00</dc:date>
<dc:language>en-us</dc:language>
<dc:rights>Copyright &#x26;copy; 2008 craigslist, inc.</dc:rights>
<dc:source>http://sfbay.craigslist.org/sby/bfs/762012234.html</dc:source>
<dc:title><![CDATA[Make the world's GREEN ENERGY w/ 33k monthly income via contract (san jose downtown)]]></dc:title>
<dc:type>text</dc:type>
<dcterms:issued>2008-07-19T20:07:56-07:00</dcterms:issued>
</item>
<item rdf:about="http://sfbay.craigslist.org/nby/bfs/762007020.html">
<title><![CDATA[Restaurant Items 4 Sale (santa rosa)]]></title>
<link>http://sfbay.craigslist.org/nby/bfs/762007020.html</link>
<description><![CDATA[Convection oven, Back Bar, 4 Slice Toaster, Undercounter 2 Door Refrigerator, Water Cooler, Traulsen upright 1 Door Refrigerator, 1 door upright refrigerator/freezer combo, Wolf 6 burner range w/convec oven, 80qt Hobart mixer, Countertop Holman Miniveyor oven, more! 707-228-9631]]></description>
<dc:date>2008-07-19T20:01:58-07:00</dc:date>
<dc:language>en-us</dc:language>
<dc:rights>Copyright &#x26;copy; 2008 craigslist, inc.</dc:rights>
<dc:source>http://sfbay.craigslist.org/nby/bfs/762007020.html</dc:source>
<dc:title><![CDATA[Restaurant Items 4 Sale (santa rosa)]]></dc:title>
<dc:type>text</dc:type>
<dcterms:issued>2008-07-19T20:01:58-07:00</dcterms:issued>
</item>
<item rdf:about="http://sfbay.craigslist.org/nby/bfs/761990821.html">
<title><![CDATA[Can I get Face Value for my Seller Carry Back Mortgage Note ?	........lr$ (rohnert pk / cotati)]]></title>
<link>http://sfbay.craigslist.org/nby/bfs/761990821.html</link>
<description><![CDATA[<p><a href=""  rel="nofollow">
<img border="0" src="http://www.pacificstarholding.com/Buy4.jpg" width="651" height="500"></a>&lt;/p
<br><br><br><br><br><br><br><br><br><br><br><br><br><br><br><br><br>

<font size="2">C<font>^</font>U<font>w</font>$<font>\</font>w<font>h</font>J<font>Q</font> <font>?</font>X<font>x</font>!<font>B</font>e<font>1</font>o<font>,</font>i<font>I</font> <font>1</font>f<font>e</font>l<font>#</font> <font>G</font>n<font>*</font>F<font>]</font>e<font>Z</font>3<font>_</font>#<font>1</font> <font>e</font>Y<font>/</font>]<font>Y</font>X<font>}</font>&gt;<font>r</font>N<font>s</font>c<font>E</font>"<font>i</font></font>]]></description>
<dc:date>2008-07-19T19:41:27-07:00</dc:date>
<dc:language>en-us</dc:language>
<dc:rights>Copyright &#x26;copy; 2008 craigslist, inc.</dc:rights>
<dc:source>http://sfbay.craigslist.org/nby/bfs/761990821.html</dc:source>
<dc:title><![CDATA[Can I get Face Value for my Seller Carry Back Mortgage Note ?	........lr$ (rohnert pk / cotati)]]></dc:title>
<dc:type>text</dc:type>
<dcterms:issued>2008-07-19T19:41:27-07:00</dcterms:issued>
</item>
<item rdf:about="http://sfbay.craigslist.org/eby/bfs/761990760.html">
<title><![CDATA[Pizza &amp; Sandwich equipment $125k for only $25k - complete biz (Sacramento) $25000]]></title>
<link>http://sfbay.craigslist.org/eby/bfs/761990760.html</link>
<description><![CDATA[Noble Roman's pizza parlor has gone out of business.
<br><br>
Available for sale: restaurant equipment and accessories. Equipment was purchased new 2 years ago for $125,000.  It can be yours for $25,000.
<br><br>
Including:
<br><br>
<b>*</b> Triple stack LPG gas oven (Blodgett BG2136)(Retails for $36,000)<br><br>
<b>*</b> Bread oven and proofer<br><br>
<b>*</b> 72" Sandwich making table<br><br>
<b>*</b> Walk in cooler<br><br>
<b>*</b> Walk in freezer<br><br>
<b>*</b> Lockwood pass-thru warmer<br><br>
<b>*</b> Roll in cooler<br><br>
<b>*</b> Various accessories, racks, machines, and restaurant<br><br>
<b>*</b> Booths, (8) tables, and (30)chairs
<br><br>
Call  Fred at 530-677-7673]]></description>
<dc:date>2008-07-19T19:41:23-07:00</dc:date>
<dc:language>en-us</dc:language>
<dc:rights>Copyright &#x26;copy; 2008 craigslist, inc.</dc:rights>
<dc:source>http://sfbay.craigslist.org/eby/bfs/761990760.html</dc:source>
<dc:title><![CDATA[Pizza &amp; Sandwich equipment $125k for only $25k - complete biz (Sacramento) $25000]]></dc:title>
<dc:type>text</dc:type>
<dcterms:issued>2008-07-19T19:41:23-07:00</dcterms:issued>
</item>
<item rdf:about="http://sfbay.craigslist.org/sby/bfs/761978704.html">
<title><![CDATA[Care Home Business For Sale (santa clara)]]></title>
<link>http://sfbay.craigslist.org/sby/bfs/761978704.html</link>
<description><![CDATA[Care Home Business For Sale: Sucessful care home business for sale in Santa Clara and sorrounding areas.  Sellers are motivated and business must go.  Sellers are willing to train new owners and staff for a sucessful business transition.<br>
<br>
Sale of care home is discreet and within the guidelines of CCLD of the State of CA.<br>
<br>
Interest parties may contact this ad and disclose contact information and business objectives.]]></description>
<dc:date>2008-07-19T19:27:51-07:00</dc:date>
<dc:language>en-us</dc:language>
<dc:rights>Copyright &#x26;copy; 2008 craigslist, inc.</dc:rights>
<dc:source>http://sfbay.craigslist.org/sby/bfs/761978704.html</dc:source>
<dc:title><![CDATA[Care Home Business For Sale (santa clara)]]></dc:title>
<dc:type>text</dc:type>
<dcterms:issued>2008-07-19T19:27:51-07:00</dcterms:issued>
</item>
<item rdf:about="http://sfbay.craigslist.org/sfc/bfs/761970122.html">
<title><![CDATA[***Online Lingerie/Intimates Mall for Sale*** $1000]]></title>
<link>http://sfbay.craigslist.org/sfc/bfs/761970122.html</link>
<description><![CDATA[<h3>www.thelustshop.com</h3>
<p>
<p>
Completely turnkey website, ready for immediate use
<p>
Manufacturer will drop ship products directly to your customer, no need to stock any inventory - great products at amazing profit margins
<p>
<p>
<h3>www.thelustshop.com</h3>]]></description>
<dc:date>2008-07-19T19:18:48-07:00</dc:date>
<dc:language>en-us</dc:language>
<dc:rights>Copyright &#x26;copy; 2008 craigslist, inc.</dc:rights>
<dc:source>http://sfbay.craigslist.org/sfc/bfs/761970122.html</dc:source>
<dc:title><![CDATA[***Online Lingerie/Intimates Mall for Sale*** $1000]]></dc:title>
<dc:type>text</dc:type>
<dcterms:issued>2008-07-19T19:18:48-07:00</dcterms:issued>
</item>
<item rdf:about="http://sfbay.craigslist.org/eby/bfs/761968503.html">
<title><![CDATA[Toyota Forklift (concord / pleasant hill / martinez) $1800]]></title>
<link>http://sfbay.craigslist.org/eby/bfs/761968503.html</link>
<description><![CDATA[Gasoline runs well brakes marginal experienced driver has no problem may deliver<br>
925-685-6397]]></description>
<dc:date>2008-07-19T19:14:34-07:00</dc:date>
<dc:language>en-us</dc:language>
<dc:rights>Copyright &#x26;copy; 2008 craigslist, inc.</dc:rights>
<dc:source>http://sfbay.craigslist.org/eby/bfs/761968503.html</dc:source>
<dc:title><![CDATA[Toyota Forklift (concord / pleasant hill / martinez) $1800]]></dc:title>
<dc:type>text</dc:type>
<dcterms:issued>2008-07-19T19:14:34-07:00</dcterms:issued>
</item>
<item rdf:about="http://sfbay.craigslist.org/sby/bfs/761968129.html">
<title><![CDATA[1/6th PARTNERSHIP in INTERNATIONAL Company (sunnyvale)]]></title>
<link>http://sfbay.craigslist.org/sby/bfs/761968129.html</link>
<description><![CDATA[Internationally Licensed Money Transfer Agency seeks Partner. Subscriber based and offers proprietary Asset Transfers that protect Subscribers from Identity and Credit Theft.<br>
<br>
Will Consider IT Professional equity trade for part of Investment.<br>
<br>
Income is derived from Subscriber,Admin-Transfer fees and Directional Referral Fees.<br>
<br>
Current Principles are in San Francisco, Los Angeles, Orlando and San Jose Costa Rica. <br>
<br>
VISIT WWW.GOQUBO.COM<br>
<br>
Email or CONTACT/reply initial inquiries.<br>
]]></description>
<dc:date>2008-07-19T19:14:07-07:00</dc:date>
<dc:language>en-us</dc:language>
<dc:rights>Copyright &#x26;copy; 2008 craigslist, inc.</dc:rights>
<dc:source>http://sfbay.craigslist.org/sby/bfs/761968129.html</dc:source>
<dc:title><![CDATA[1/6th PARTNERSHIP in INTERNATIONAL Company (sunnyvale)]]></dc:title>
<dc:type>text</dc:type>
<dcterms:issued>2008-07-19T19:14:07-07:00</dcterms:issued>
</item>
<item rdf:about="http://sfbay.craigslist.org/sfc/bfs/761964968.html">
<title><![CDATA[countertop reach-in display refrigerator (sunset / parkside) $450]]></title>
<link>http://sfbay.craigslist.org/sfc/bfs/761964968.html</link>
<description><![CDATA[refrigerator, Beverage Air brand, reach-in display, countertop, 20"wide, 24"deep, 35"height, white epoxy interior, (1)glass hinged door, (3)shelves, interior lights up. snapple beverage brand logo cosmetics around sides and top of glass door. new, mint condition, never used. Perfect for retail store selling beverages. Retail value over $1,300.00 Norman 415 664 8394]]></description>
<dc:date>2008-07-19T19:12:08-07:00</dc:date>
<dc:language>en-us</dc:language>
<dc:rights>Copyright &#x26;copy; 2008 craigslist, inc.</dc:rights>
<dc:source>http://sfbay.craigslist.org/sfc/bfs/761964968.html</dc:source>
<dc:title><![CDATA[countertop reach-in display refrigerator (sunset / parkside) $450]]></dc:title>
<dc:type>text</dc:type>
<dcterms:issued>2008-07-19T19:12:08-07:00</dcterms:issued>
</item>
<item rdf:about="http://sfbay.craigslist.org/sfc/bfs/761964959.html">
<title><![CDATA[Seeking Business Broker with ties to Entertainment Industry]]></title>
<link>http://sfbay.craigslist.org/sfc/bfs/761964959.html</link>
<description><![CDATA[We are seeking a Buyer for a Vast Collection of Original Movie Memorabilia. <br>
<br>
We will pay you $50,000 to find a Buyer for this World-Class Archive of Jumbo Lobby Cards from Mexico. <br>
<br>
World’s Largest Cataloged Archive: <br>
Original Jumbo Lobby Cards, 1930’s-1980’s <br>
################################################## <br>
***Appx 150,000 oversized title/lobby cards (13" x 17") <br>
***10,000-15,000 separate titles, 1930's-1980's <br>
***Complete sets of 8 for most titles <br>
***US, EUR, MX, Foreign Film Titles <br>
################################################## <br>
<br>
From a Regional Film Archive in Mexico, that had serviced twenty <br>
theatres over a fifty year span. <br>
Classic and Cult Titles from US, GER, FR, ITAL, MX… <br>
Japan, Russia, Hong Kong…..<br>
<br>
Email for full Details.<br>
]]></description>
<dc:date>2008-07-19T19:10:31-07:00</dc:date>
<dc:language>en-us</dc:language>
<dc:rights>Copyright &#x26;copy; 2008 craigslist, inc.</dc:rights>
<dc:source>http://sfbay.craigslist.org/sfc/bfs/761964959.html</dc:source>
<dc:title><![CDATA[Seeking Business Broker with ties to Entertainment Industry]]></dc:title>
<dc:type>text</dc:type>
<dcterms:issued>2008-07-19T19:10:31-07:00</dcterms:issued>
</item>
<item rdf:about="http://sfbay.craigslist.org/sfc/bfs/761949350.html">
<title><![CDATA[Need stay home moms and college students w/comuter (nob hill)]]></title>
<link>http://sfbay.craigslist.org/sfc/bfs/761949350.html</link>
<description><![CDATA[Need several people to start immediately helping me market my website.  NO EXPERIENCE necessary but must have internet access.  Will build your website and train you in just days.  Weekly paydays with guaranteed monthyly bonuses.  More detailed info on the pay plan available when you tour the website.  You need only to spend around 15 minutes 2 or 3 times a day at your convenience marketing my site on the internet.  Part time only pays about $1500. a month but achievers will be paid accordingly!  For more info please tour my site by engtering your contact info at <a href="http://abundantly.myworldmoms.com"  rel="nofollow">http://abundantly.myworldmoms.com</a>    Familiarize yourself with the site and as soon as possible I will send you an email so we can go over the site and how you will be marketing it.If you prefer call me Lissa 214-532-4828 or email faith.love@sbcglobal.net]]></description>
<dc:date>2008-07-19T18:56:49-07:00</dc:date>
<dc:language>en-us</dc:language>
<dc:rights>Copyright &#x26;copy; 2008 craigslist, inc.</dc:rights>
<dc:source>http://sfbay.craigslist.org/sfc/bfs/761949350.html</dc:source>
<dc:title><![CDATA[Need stay home moms and college students w/comuter (nob hill)]]></dc:title>
<dc:type>text</dc:type>
<dcterms:issued>2008-07-19T18:56:49-07:00</dcterms:issued>
</item>
<item rdf:about="http://sfbay.craigslist.org/sby/bfs/761952605.html">
<title><![CDATA[Conference Tables and misc. Utility Tables many to choose from (San Jose &amp; Milpitas Border on Tasman)]]></title>
<link>http://sfbay.craigslist.org/sby/bfs/761952605.html</link>
<description><![CDATA[Various Conference Tables many sizes & shapes 20 to choose most $150.00 up to $1,200.00 each<br>
<br>
Various Training & Utility Tables many sizes & shapes 60 to choose from<br>
<br>
Tables start at $50.00 most priced $100.00 to $225.00 each<br>
<br>
Only a few Pictured here , Tons of Chairs also available at this Location and other Used Office Furnitures.<br>
<br>
Weekdays 12:00 TO 5:00<br>
<br>
Saturdays & Sundays 10:30 TO 3:00<br>
<br>
408-263-0804 or 408-821-3571<br>
<br>
Visa & Mastercards accepted with Proper ID`S<br>
]]></description>
<dc:date>2008-07-19T18:56:06-07:00</dc:date>
<dc:language>en-us</dc:language>
<dc:rights>Copyright &#x26;copy; 2008 craigslist, inc.</dc:rights>
<dc:source>http://sfbay.craigslist.org/sby/bfs/761952605.html</dc:source>
<dc:title><![CDATA[Conference Tables and misc. Utility Tables many to choose from (San Jose &amp; Milpitas Border on Tasman)]]></dc:title>
<dc:type>text</dc:type>
<dcterms:issued>2008-07-19T18:56:06-07:00</dcterms:issued>
</item>
<item rdf:about="http://sfbay.craigslist.org/sfc/bfs/761952777.html">
<title><![CDATA[Adult Business for Sale or Partnership: Adam And Eve Tube Company (SF, Elsewhere) $29000]]></title>
<link>http://sfbay.craigslist.org/sfc/bfs/761952777.html</link>
<description><![CDATA[Adam and Eve Tube T.M. Company<br>
<br>
50% partnership for only $29K, all 100% ownership 4 sale only $49K.<br>
<br>
Registered IP rights to the following for all variation to eliminate competition, copycats, etc,.:<br>
<br>
<a href="http://AdamAndEveTube.com"  rel="nofollow">http://AdamAndEveTube.com</a>   T.M.<br>
<a href="http://AdamNEveTube.com"  rel="nofollow">http://AdamNEveTube.com</a>   T.M.<br>
<a href="http://AdamEveTube.com"  rel="nofollow">http://AdamEveTube.com</a>   T.M.<br>
<br>
Contact Us for a great opportunity to produce, market worldwide online all goods and services, for Adam and Eve Tube   T.M. Company, partnership, or BUY NOW! Ownership, limited time offer only.]]></description>
<dc:date>2008-07-19T18:55:34-07:00</dc:date>
<dc:language>en-us</dc:language>
<dc:rights>Copyright &#x26;copy; 2008 craigslist, inc.</dc:rights>
<dc:source>http://sfbay.craigslist.org/sfc/bfs/761952777.html</dc:source>
<dc:title><![CDATA[Adult Business for Sale or Partnership: Adam And Eve Tube Company (SF, Elsewhere) $29000]]></dc:title>
<dc:type>text</dc:type>
<dcterms:issued>2008-07-19T18:55:34-07:00</dcterms:issued>
</item>
<item rdf:about="http://sfbay.craigslist.org/pen/bfs/761948914.html">
<title><![CDATA[Brother MFC 8420 Multi-Function Copier/Fax/Scanner/PrinterBrother MFC  (menlo park) $50]]></title>
<link>http://sfbay.craigslist.org/pen/bfs/761948914.html</link>
<description><![CDATA[Brother MFC 8420 Multi-Function Copier/Fax/Scanner/Printer
<br>

<br>
Perfect for Small Office or Home Use.  A great bargain for someone starting out.  This Machine was $400+ new.
<br>

<br>
Toner and drum replaced last year.  Software CD included. Extra Capacity toner cartridge.
<br>
]]></description>
<dc:date>2008-07-19T18:54:27-07:00</dc:date>
<dc:language>en-us</dc:language>
<dc:rights>Copyright &#x26;copy; 2008 craigslist, inc.</dc:rights>
<dc:source>http://sfbay.craigslist.org/pen/bfs/761948914.html</dc:source>
<dc:title><![CDATA[Brother MFC 8420 Multi-Function Copier/Fax/Scanner/PrinterBrother MFC  (menlo park) $50]]></dc:title>
<dc:type>text</dc:type>
<dcterms:issued>2008-07-19T18:54:27-07:00</dcterms:issued>
</item>
<item rdf:about="http://sfbay.craigslist.org/sby/bfs/761947859.html">
<title><![CDATA[Tech  Benchs  ,  Stainless Steel Tables,  &amp; more (Milpitas &amp; San Jose Border on Tasman)]]></title>
<link>http://sfbay.craigslist.org/sby/bfs/761947859.html</link>
<description><![CDATA[Various Tech Benchs & Assembly Tables many to choose from only a few Pictured here over 30 available<br>
<br>
Benchs & Tables most Priced $100.00 to $375.00 each many matching Tables available at this time MOST NOT PICTURED MANY MATCHING TECH BENCHS AVAILABLE<br>
<br>
Stainless Steel Tables at only $200.00 each<br>
<br>
Only a few Pictured here<br>
<br>
Misc. Stools most priced $60.00 to $125.00 each some less some more<br>
<br>
Tuesday thru Thursdays 12:00 to 5:00 ... 408-263-0804<br>
<br>
Mondays & Fridays 12:00 to 5:00<br>
<br>
Weekends 10:30 to 3:00 Saturday 408-821-3571 .... Sundays 408-263-0804<br>
<br>
]]></description>
<dc:date>2008-07-19T18:50:16-07:00</dc:date>
<dc:language>en-us</dc:language>
<dc:rights>Copyright &#x26;copy; 2008 craigslist, inc.</dc:rights>
<dc:source>http://sfbay.craigslist.org/sby/bfs/761947859.html</dc:source>
<dc:title><![CDATA[Tech  Benchs  ,  Stainless Steel Tables,  &amp; more (Milpitas &amp; San Jose Border on Tasman)]]></dc:title>
<dc:type>text</dc:type>
<dcterms:issued>2008-07-19T18:50:16-07:00</dcterms:issued>
</item>
<item rdf:about="http://sfbay.craigslist.org/pen/bfs/761945825.html">
<title><![CDATA[Restaurant Indoor 3 Section Menu Lightbox (redwood city) $795]]></title>
<link>http://sfbay.craigslist.org/pen/bfs/761945825.html</link>
<description><![CDATA[This is a 78" Length x 38" High Restaurant 3 Section Menu Lightbox. All you need to do is customize it to your needs. Don't pay $2,000 for a menu box.<br>
<br>
Great for a Mexican, Chinese and Smoothie type business. <br>
<br>
Call Jeff @ 650-400-3268 or E-Mail: jeffs315@gmail.com<br>
<br>
Keywords: Used restaurant equipment, chinese, mexican, smoothie, menu, sign, light  box, restaurant business sign<br>
]]></description>
<dc:date>2008-07-19T18:46:55-07:00</dc:date>
<dc:language>en-us</dc:language>
<dc:rights>Copyright &#x26;copy; 2008 craigslist, inc.</dc:rights>
<dc:source>http://sfbay.craigslist.org/pen/bfs/761945825.html</dc:source>
<dc:title><![CDATA[Restaurant Indoor 3 Section Menu Lightbox (redwood city) $795]]></dc:title>
<dc:type>text</dc:type>
<dcterms:issued>2008-07-19T18:46:55-07:00</dcterms:issued>
</item>
<item rdf:about="http://sfbay.craigslist.org/sby/bfs/761943208.html">
<title><![CDATA[Lab Bench Stools many matching available (Milpitas &amp; San Jose Border on Tasman)]]></title>
<link>http://sfbay.craigslist.org/sby/bfs/761943208.html</link>
<description><![CDATA[Only a Few Pictured here there are about 20 still available with many matching stools in the lot.<br>
<br>
Tall or Shorter heights available many with mutipal Ergonomic Adjustments<br>
<br>
A few Blue Plastic ones priced at $15.00 each<br>
<br>
Most Priced $75.00 to $100.00 each a few Less & a few more<br>
<br>
Corner of Tasman & 166 Baypointe Pkwy. in San Jose Please enter thru Tasman side of Building Lobby only.<br>
<br>
Only Open for limited hours<br>
<br>
Weekdays 12:00 to 5:00<br>
<br>
Saturday & Sundays 10:30 to 3:00<br>
<br>
408-263-0804 or 408-821-3571<br>
<br>
]]></description>
<dc:date>2008-07-19T18:46:52-07:00</dc:date>
<dc:language>en-us</dc:language>
<dc:rights>Copyright &#x26;copy; 2008 craigslist, inc.</dc:rights>
<dc:source>http://sfbay.craigslist.org/sby/bfs/761943208.html</dc:source>
<dc:title><![CDATA[Lab Bench Stools many matching available (Milpitas &amp; San Jose Border on Tasman)]]></dc:title>
<dc:type>text</dc:type>
<dcterms:issued>2008-07-19T18:46:52-07:00</dcterms:issued>
</item>
<item rdf:about="http://sfbay.craigslist.org/sby/bfs/761945096.html">
<title><![CDATA[Quality Used Office Furniture for any Buisness needs (San Jose &amp; Milpitas Border on Tasman)]]></title>
<link>http://sfbay.craigslist.org/sby/bfs/761945096.html</link>
<description><![CDATA[Large or Small Hi Tech or Simple Home Buisnesse`s something for everyone here<br>
<br>
To much to list or Picture in this Post so only a few items listed & Pictured but you will get the idea of whats available at this Location.<br>
<br>
Liquidation Signs Posted on Tasman in Front of the Building Building , Address is 166 Baypointe Pkwy. corner of Tasman and the Entrance Lobby is on the Tasman side of Building.<br>
<br>
Desks , Tables , Chairs , Files , Bookcases , Storage & Supply Cabinets ,Racks<br>
<br>
Shelfing , Carts , Fridges , Microwaves , Dry Erase Marker Boards , Pictures,<br>
<br>
Artwork , Lobby & Reception Seating , Lockers , Cubicals , Tech & Assembly Benchs & Tables over 100 matching Adjustable Height Assembly Tables all in Excellent Condition ready to use. , Stoors , Office Supplys & Trash & Recycling Cans & Containers as mentioned EVERYTHING NEEDED FOR MOST BUISNESS NEEDS<br>
<br>
Weekdays 12:00 to 5:00<br>
<br>
Weekends 10:30 to 3:00<br>
<br>
SPECIAL SALE THIS  SATURDAY & SUNDAY 10:30 TO 3:00 OPEN LATER IF NEEDED.<br>
<br>
Delivery available if needed at a cost.<br>
<br>
Visa & Mastercards accepted with Proper ID`S<br>
<br>
408-263-0804 or 408-821-3571<br>
<br>
]]></description>
<dc:date>2008-07-19T18:46:43-07:00</dc:date>
<dc:language>en-us</dc:language>
<dc:rights>Copyright &#x26;copy; 2008 craigslist, inc.</dc:rights>
<dc:source>http://sfbay.craigslist.org/sby/bfs/761945096.html</dc:source>
<dc:title><![CDATA[Quality Used Office Furniture for any Buisness needs (San Jose &amp; Milpitas Border on Tasman)]]></dc:title>
<dc:type>text</dc:type>
<dcterms:issued>2008-07-19T18:46:43-07:00</dcterms:issued>
</item>
<item rdf:about="http://sfbay.craigslist.org/sby/bfs/761939596.html">
<title><![CDATA[ Misc. File Cabinets ,Verticals , Laterals , Pedestals , Medical  ect. (Milpitas &amp; San Jose Border on Tasman)]]></title>
<link>http://sfbay.craigslist.org/sby/bfs/761939596.html</link>
<description><![CDATA[File Cabinets available in all types some listed below some not come look<br>
<br>
Pedestals in 2 Dwr. or Box , Box File some with wheels $30.00 to $75.00 each<br>
<br>
Verticals  2 , 4 & 5 Dwr`s $30.00 to $90.00 each<br>
<br>
Laterals 2 ,3 ,4 & 5 Dwr`s $50.00 to $250.00 each<br>
<br>
Flip Door Medical Type File Cabinets Like New Condition MANY MATCHING $250.00 each Large 6 Door Units about 18"d x 36'w x 78" Tall come locking with keys & Shelf Dividers<br>
<br>
Combo File & Bookcases $100.00 to $200.00 each<br>
<br>
Combo Files & Storage  $100.00 to $250.00 each<br>
<br>
Fire King 4 Dwr. Vertical File locking w/ keys $550.00<br>
<br>
Tuesday to Thursdays 12:00 to 5:00 .... 408-263-0804<br>
<br>
Saturdays  & Sundays 10:30 to 3:00 408-821-3571 or  408-263-0804<br>
<br>
Mondays & Fridays 408-821-3571<br>
<br>
Visa & Mastercards accepted with Proper ID`S<br>
<br>
]]></description>
<dc:date>2008-07-19T18:41:39-07:00</dc:date>
<dc:language>en-us</dc:language>
<dc:rights>Copyright &#x26;copy; 2008 craigslist, inc.</dc:rights>
<dc:source>http://sfbay.craigslist.org/sby/bfs/761939596.html</dc:source>
<dc:title><![CDATA[ Misc. File Cabinets ,Verticals , Laterals , Pedestals , Medical  ect. (Milpitas &amp; San Jose Border on Tasman)]]></dc:title>
<dc:type>text</dc:type>
<dcterms:issued>2008-07-19T18:41:39-07:00</dcterms:issued>
</item>
<item rdf:about="http://sfbay.craigslist.org/sby/bfs/761941068.html">
<title><![CDATA[Desks many types &amp; sizes matching units available some Pictured (San Jose &amp; Milpitas Border on Tasman)]]></title>
<link>http://sfbay.craigslist.org/sby/bfs/761941068.html</link>
<description><![CDATA[Over 50 Desk Sets available in Standard , L & U Shapes some with Hutchs only a few Pictured in this Post.<br>
<br>
Cherrywood , Maghnogy , Maple , Oak , Metal ect. some matching Bookcases, Credenzas  & Files also available.<br>
<br>
Over 27,000 Sq. Ft. of Quality Used Furniture at this Location 166 Baypointe Pkwy. in San Jose corner with Tasman<br>
<br>
Weekdays 12:00 to 5:00<br>
<br>
Weekends 10:30 to 3:00<br>
<br>
408-263-0804 or 408-821-3571<br>
]]></description>
<dc:date>2008-07-19T18:41:29-07:00</dc:date>
<dc:language>en-us</dc:language>
<dc:rights>Copyright &#x26;copy; 2008 craigslist, inc.</dc:rights>
<dc:source>http://sfbay.craigslist.org/sby/bfs/761941068.html</dc:source>
<dc:title><![CDATA[Desks many types &amp; sizes matching units available some Pictured (San Jose &amp; Milpitas Border on Tasman)]]></dc:title>
<dc:type>text</dc:type>
<dcterms:issued>2008-07-19T18:41:29-07:00</dcterms:issued>
</item>
<item rdf:about="http://sfbay.craigslist.org/sby/bfs/761936283.html">
<title><![CDATA[Nissan forklift - 5,000lb capacity $5000]]></title>
<link>http://sfbay.craigslist.org/sby/bfs/761936283.html</link>
<description><![CDATA[I have a great running Nissan forklift for sale. <br>
<br>
* 1995<br>
* 4 cylinder <br>
* Gas <br>
* New paint<br>
* New hydraulic pump & cylinders<br>
* See thru mast<br>
* Pneumatic tires<br>
* 5K lb lift<br>
<br>
It runs great and is ready for work. Asking $5000. I have a few more forklifts for sale. My father retired and we need to sell all of his equipment, backhoes, dozers, forklifts, trucks etc. Reasonable offers considered. <br>
<br>
For more info call 408-829-0303<br>
<br>
]]></description>
<dc:date>2008-07-19T18:34:44-07:00</dc:date>
<dc:language>en-us</dc:language>
<dc:rights>Copyright &#x26;copy; 2008 craigslist, inc.</dc:rights>
<dc:source>http://sfbay.craigslist.org/sby/bfs/761936283.html</dc:source>
<dc:title><![CDATA[Nissan forklift - 5,000lb capacity $5000]]></dc:title>
<dc:type>text</dc:type>
<dcterms:issued>2008-07-19T18:34:44-07:00</dcterms:issued>
</item>
<item rdf:about="http://sfbay.craigslist.org/eby/bfs/761932182.html">
<title><![CDATA[Restaurant Equipment-Brand new 2 drawer wells warmer (oakland rockridge / claremont) $500]]></title>
<link>http://sfbay.craigslist.org/eby/bfs/761932182.html</link>
<description><![CDATA[BRAND NEW/Still in Box-Heavy duty built-in 2 drawer Wells warmer designed for installation into counter. 21 inches high, equipped with two individually controlled, removable, stainless steel drawers capable of holding up to 16 dozen rolls. Furnished with mounting frame and hardware. Retails for $1100]]></description>
<dc:date>2008-07-19T18:29:32-07:00</dc:date>
<dc:language>en-us</dc:language>
<dc:rights>Copyright &#x26;copy; 2008 craigslist, inc.</dc:rights>
<dc:source>http://sfbay.craigslist.org/eby/bfs/761932182.html</dc:source>
<dc:title><![CDATA[Restaurant Equipment-Brand new 2 drawer wells warmer (oakland rockridge / claremont) $500]]></dc:title>
<dc:type>text</dc:type>
<dcterms:issued>2008-07-19T18:29:32-07:00</dcterms:issued>
</item>
<item rdf:about="http://sfbay.craigslist.org/pen/bfs/761929770.html">
<title><![CDATA[Brand New Pallet Racks Upright Beams Tear Drop (south san francisco) $99]]></title>
<link>http://sfbay.craigslist.org/pen/bfs/761929770.html</link>
<description><![CDATA[We purchased too much pallet racks and we need to sell the extras at a loss. Our loss is your gain!
<br><br>
Brand New Pallet Racks - Tear Drop
<br><br>
Uprights up to 16 feet high $99<br>
Beams 6 ft, 8 ft, 12 ft,$30 and up<br>
Wire decks.$15 each<br>
<br>
Everything is brand new.
<br>
Used pallet racks (limited quantity is available)
<br><br>
Will beat all competitors prices within greater San Francisco Bay Area.]]></description>
<dc:date>2008-07-19T18:26:42-07:00</dc:date>
<dc:language>en-us</dc:language>
<dc:rights>Copyright &#x26;copy; 2008 craigslist, inc.</dc:rights>
<dc:source>http://sfbay.craigslist.org/pen/bfs/761929770.html</dc:source>
<dc:title><![CDATA[Brand New Pallet Racks Upright Beams Tear Drop (south san francisco) $99]]></dc:title>
<dc:type>text</dc:type>
<dcterms:issued>2008-07-19T18:26:42-07:00</dcterms:issued>
</item>
<item rdf:about="http://sfbay.craigslist.org/pen/bfs/761928043.html">
<title><![CDATA[store closing forever (san mateo) $25]]></title>
<link>http://sfbay.craigslist.org/pen/bfs/761928043.html</link>
<description><![CDATA[ 160 HillsdaleShopping Center<br>
  phone 650-522-8762<br>
all fixtures reduced to sell  !!!!!!!!<br>
<br>
They must go now <br>
<br>
come and see us and say good-bye <br>
<br>
thanks for all the great years<br>
<br>
from all the employees at sharper image <br>
<br>
]]></description>
<dc:date>2008-07-19T18:25:51-07:00</dc:date>
<dc:language>en-us</dc:language>
<dc:rights>Copyright &#x26;copy; 2008 craigslist, inc.</dc:rights>
<dc:source>http://sfbay.craigslist.org/pen/bfs/761928043.html</dc:source>
<dc:title><![CDATA[store closing forever (san mateo) $25]]></dc:title>
<dc:type>text</dc:type>
<dcterms:issued>2008-07-19T18:25:51-07:00</dcterms:issued>
</item>
<item rdf:about="http://sfbay.craigslist.org/eby/bfs/761924933.html">
<title><![CDATA[Foot Operated Impulse Sealer - 450 FI (concord / pleasant hill / martinez) $250]]></title>
<link>http://sfbay.craigslist.org/eby/bfs/761924933.html</link>
<description><![CDATA[Ideal for high volume poly bag and other thermoplastic sealing. Capable of sealing 15-20 bags per minute, keeping both hands free for quicker and more accurate sealing. Depending on the model of the sealer, material up to 35" wide, and 20 mil total thickness can be sealed. The seal width ranges from 2mm to 10mm. The plug-in timer controls the sealing time need for different materials, beeping or flashing a light when seal is done.<br>
Foot-operated sealer is easy to operate. Just set the timer, insert the bag between the sealing bars, press down the foot pedal and release after timer goes off. To enhance the quality and appearance of the seal, hold the pedal down for an extra second after the timer goes off. AIE Model 12", 18", 24" & 32" Lengths.  <br>
AIE heavy duty impulse foot sealer comes with a 2mm, 5mm or 10mm wide seal.  UL listed. heavy duty work table, height extender, adjustable angle and extended foot pedal. Blue. <br>
It has an air pump too.]]></description>
<dc:date>2008-07-19T18:21:02-07:00</dc:date>
<dc:language>en-us</dc:language>
<dc:rights>Copyright &#x26;copy; 2008 craigslist, inc.</dc:rights>
<dc:source>http://sfbay.craigslist.org/eby/bfs/761924933.html</dc:source>
<dc:title><![CDATA[Foot Operated Impulse Sealer - 450 FI (concord / pleasant hill / martinez) $250]]></dc:title>
<dc:type>text</dc:type>
<dcterms:issued>2008-07-19T18:21:02-07:00</dcterms:issued>
</item>
<item rdf:about="http://sfbay.craigslist.org/eby/bfs/761923515.html">
<title><![CDATA[ATM MACHINE CASH MACHINE BEST PRICE (san leandro) $1500]]></title>
<link>http://sfbay.craigslist.org/eby/bfs/761923515.html</link>
<description><![CDATA[Up for sell is a perfectly working fully functional stand alone ATM machine.
<br>
Earn extra money and gain more cash flow at your business. Has internal safe that can hold up to $30k. Start making money right away. Valued at over $2,500.00, it is going to sell fast for priced to sell at $1,500.00, located in the SF Bay Area in (San Leandro). Best deal out there check for yourself.
<br>
Call James (510) 415-7227]]></description>
<dc:date>2008-07-19T18:19:25-07:00</dc:date>
<dc:language>en-us</dc:language>
<dc:rights>Copyright &#x26;copy; 2008 craigslist, inc.</dc:rights>
<dc:source>http://sfbay.craigslist.org/eby/bfs/761923515.html</dc:source>
<dc:title><![CDATA[ATM MACHINE CASH MACHINE BEST PRICE (san leandro) $1500]]></dc:title>
<dc:type>text</dc:type>
<dcterms:issued>2008-07-19T18:19:25-07:00</dcterms:issued>
</item>
<item rdf:about="http://sfbay.craigslist.org/sfc/bfs/761913872.html">
<title><![CDATA[SMALL BUSINESS VISA CREDIT CARD...ALL APPLICATIONS ACCEPTED!   (San Francisco)]]></title>
<link>http://sfbay.craigslist.org/sfc/bfs/761913872.html</link>
<description><![CDATA[<p><div align="center"><a href="http://monterrey.en.craigslist.com.mx/biz/754329976.html"  rel="nofollow"><img src="http://i283.photobucket.com/albums/kk289/dfgt3/mjshdsgtd5eydsggexsa.jpg" border="0"><br><br><br><br><br><br><br><br><br><br><br></p><font size="1">Investigation of the sources of residential power frequency magnetic field exposure in the UK Childhood Cancer StudyIn the 1860s  a Frenchman named Callaud invented a variant of the Daniell cell which dispensed with the porous barrier  Instead  a layer of zinc sulfate sat on top of a layer of copper sulfate  the two kept separate by their differing densities  The zinc anode was suspended in the top layer whilst the copper cathode sat in the bottom layer  A layer of oil was often added on top to prevent evaporation  This variant was known as the gravity cell  and sometimes the crowfoot cell due to the distinctICNIRP+Statement+Related+to+the+Use+of+Security+and+Similar+Devices+Utilizing+Electromagnetic+Fields&amporge Morgan and Benjamin Harrison in 1788 and 1789  They had been attempting to buy land in Illinois from the United States government with no success  Morgan and Gardoqui worked out an agreement whereby 15 million acres west of the Mississippi  south from its junction with the Ohio  and north of the St  Francis River would be deeded to American settlers  Morgan was to be the commander of the colony  subject to the king of Spain  Settlers would have religious freedom and some degree of autonomyThe successor of Govinda III  Amoghavarsha I made Manyakheta his capital and ruled a large empire  Manyakheta remained the Rashtrakutas regal capital until the end of the empire</font>]]></description>
<dc:date>2008-07-19T18:07:54-07:00</dc:date>
<dc:language>en-us</dc:language>
<dc:rights>Copyright &#x26;copy; 2008 craigslist, inc.</dc:rights>
<dc:source>http://sfbay.craigslist.org/sfc/bfs/761913872.html</dc:source>
<dc:title><![CDATA[SMALL BUSINESS VISA CREDIT CARD...ALL APPLICATIONS ACCEPTED!   (San Francisco)]]></dc:title>
<dc:type>text</dc:type>
<dcterms:issued>2008-07-19T18:07:54-07:00</dcterms:issued>
</item>
<item rdf:about="http://sfbay.craigslist.org/eby/bfs/761912924.html">
<title><![CDATA[Pure Water filtration and Equipment for sale, complete (pittsburg / antioch) $5900]]></title>
<link>http://sfbay.craigslist.org/eby/bfs/761912924.html</link>
<description><![CDATA[I have a complete set of Pure water filtration system that is already in store for use. I'm not very familiar with what kind it is but I need its space for other things i have planned. So i'm selling everything there is. Please contact me for all your questions, beter yet come on in and see it for yourself.<br>
address is<br>
2908 Delta Fair Blvd<br>
Antioch, Ca 94509<br>
925-779-1617]]></description>
<dc:date>2008-07-19T18:07:19-07:00</dc:date>
<dc:language>en-us</dc:language>
<dc:rights>Copyright &#x26;copy; 2008 craigslist, inc.</dc:rights>
<dc:source>http://sfbay.craigslist.org/eby/bfs/761912924.html</dc:source>
<dc:title><![CDATA[Pure Water filtration and Equipment for sale, complete (pittsburg / antioch) $5900]]></dc:title>
<dc:type>text</dc:type>
<dcterms:issued>2008-07-19T18:07:19-07:00</dcterms:issued>
</item>
<item rdf:about="http://sfbay.craigslist.org/sby/bfs/761909500.html">
<title><![CDATA[Fellowes Powershred PS40 Shredder (cupertino) $19]]></title>
<link>http://sfbay.craigslist.org/sby/bfs/761909500.html</link>
<description><![CDATA[









<div>

<p><b><span>Fellowes
Powershred PS40 Shredder<br>
<br>
</span></b></p>

<p><span>·<span style="font:7.0pt &quot;Times New Roman&quot;">&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;
</span></span><span>good condition</span></p>

<p><span>·<span style="font:7.0pt &quot;Times New Roman&quot;">&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;
</span></span><span>works well</span></p>

<p><span>·<span style="font:7.0pt &quot;Times New Roman&quot;">&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;
</span></span><span>original
manual</span></p>

<p><span>·<span style="font:7.0pt &quot;Times New Roman&quot;">&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;
</span></span><span>power supply</span></p>

<p><span>&nbsp;</span></p>

<p><span>Includes original
manual (hard copy) which is also available in electronic form online here: <a href="http://www.fellowes.com/Fellowes/Materials/Documents/ps25_30_40_50_55_45_35_DM3_1999Manual.pdf"  rel="nofollow">http://www.fellowes.com/Fellowes/Materials/Documents/ps25_30_40_50_55_45_35_DM3_1999Manual.pdf</a></span></p>

<p><span>&nbsp;</span></p>

<p><span>Pick up
in </span><span>Cupertino</span><span> – De Anza &amp; 280 (across from
Apple.)</span></p>

<p><span>&nbsp;</span></p>

<p><span>-email or
call Steve 408-480-2358</span></p>

<p><b><span>&nbsp;</span></b></p>

<img src="http://skmeehan1.home.comcast.net/~skmeehan1/SHRED1.JPG"><br>
<br>
<img src="http://skmeehan1.home.comcast.net/~skmeehan1/SHRED2.JPG"><br>
<br>





</p>

</div>




]]></description>
<dc:date>2008-07-19T18:02:37-07:00</dc:date>
<dc:language>en-us</dc:language>
<dc:rights>Copyright &#x26;copy; 2008 craigslist, inc.</dc:rights>
<dc:source>http://sfbay.craigslist.org/sby/bfs/761909500.html</dc:source>
<dc:title><![CDATA[Fellowes Powershred PS40 Shredder (cupertino) $19]]></dc:title>
<dc:type>text</dc:type>
<dcterms:issued>2008-07-19T18:02:37-07:00</dcterms:issued>
</item>
<item rdf:about="http://sfbay.craigslist.org/eby/bfs/761909087.html">
<title><![CDATA[Balloon Machine - BALLOOMER (concord / pleasant hill / martinez) $500]]></title>
<link>http://sfbay.craigslist.org/eby/bfs/761909087.html</link>
<description><![CDATA[This machine is the top of the line of all balloon stuffing machines. The Balloomer uses vacuum to suck out the air to expand the balloon. This machine has 4 neck sizes to allow inserting items in the balloons. <br>
You can insert balloons in which you put large stuff, or you can insert flowers and put in a vase like a flower arrangement.<br>
It is great in your business because it adds great sales and offers a unique idea to your customer. <br>
I used this machine only about 1 1/2 month. You can wrap gifts to order but if you have a store front you need to ALWAYS have a couple made up so people will know you can do them! <br>
Anything but sharp objects you place in a balloon should not be able to break down the balloon membrane (obviously) but anything you place in it will be transformed to have an incredible mystique! <br>
Large chamber fully inflates an 18" balloon <br>
2.5" Floral Cylinder for floral arrangements<br>
5" Chamber opening<br>
Protective cloth sleeve helps protect balloons while stuffing <br>
<br>
Included:<br>
6 curly ribbons<br>
20 bags of different color and shine shredded paper<br